KEGG   Xiphophorus maculatus (southern platyfish): 102219854Help
Entry
102219854         CDS       T02923                                 

Gene name
ehmt1
Definition
(RefSeq) histone-lysine N-methyltransferase EHMT1 isoform X4
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102219854 (ehmt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xma03036]
    102219854 (ehmt1)
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102219854 (ehmt1)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102219854 (ehmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 SET Pre-SET
Motif
Other DBs
NCBI-GeneID: 102219854
NCBI-ProteinID: XP_014329619
Ensembl: ENSXMAG00000007338
LinkDB All DBs
Position
8
AA seq 1276 aa AA seqDB search
MRRKQPAGLAVENVAPPKKEGLDPPKHGEEKSDEDKDVASAAGRASPAAAEAIMLNGAES
EDGSRHADLAVSGIKTAVNENGTAETETPHGSVTGSNGFILAKEQQQDGDAAPASGVSSP
LRTNRLPSGGSPSGGQTAKPLNATAAVAGCAQSSGALRTDPGTGNMLDAKNGFASSPVTI
PPPVTVHRARKTMSRPAVSPAQKLINKELRQANSVKSDSPVAPDVQKSSPPPPAPAQNHL
PQSPPETPASAHTASPAAPTEPAAPADSPAPAKLRLGPYSTVFSSRKKKRRMGTYSLVPK
KKTKVLKQRTMLEMFKELQQSAKTQQKREAANVNGEKVVNASEEDESEDMESEEETRRQP
AEQTLPAVQETSESAAQVKDEHESEDSEEDEGEEEEEGTESDLSFESSLKKKLKKKSKAD
GAWLRPSRKRKRRMTAKEPETDVLPQTSGQEFTEILPSECVDLSKSSHSSEPSGSAIEEA
QELPLCSCRMETPKSREILILADRKCMATESVDGQLTRCQGAVLKHEMMRPSNSVQLLVL
CEDHRSGMVKHQCCPGCGFFCRAGTFMECQPDVSISHRFHQACASMLKGQSFCPHCGEEA
AKAKEVTIAKADTTSTVPPAQAKGPATPGAPEGRADTTTDSSSCLSPVAEISGRADSSLS
AHPAPDPDDPAIPGSSRQPSLQSGIGTIAPPTLPLGTTKETLESVLVALDTEKPKKLRFH
PKQLFLSAKQGELKKVVLMLVDGTDPNFKMDSQNKRTPLHAAAEGGYADICHMLVQAGAN
LDMCDEDQRTPLMEACENNHMEVVLYLLRAGASAMHKDVEGFTCLHLAAKSGHYSVVEHL
LSTGLVDVNCQDDGGWTAMIWATEYKHVDQVKLLLSKGADINIRDKEKNICLHWAAFSGS
VEISEVLLNAQCDLQAVNVHGDSPLHIAARENRLDCVKLFLSRGANVFLKNREGETPPDC
CSHNSKAWGALHAHKRERDAKNGRLRQTEEKLLHSDISLGQEQVSIPCVNSVDSEPIPDD
YKYITENCVTSPMNIDRNITHLQYCVCKEDCSTSICMCGQLSLRRWYDKSGCLLPEFCRE
EPPLIFECNHACSCWRTCKNRVVQNGLRVRLEVFRTGNKGWGVRTLQDIPQGSFVCEYVG
EIISEGEADTRQNDAYLFSLDDKPEDQYCIDARFYGNISRFLNHMCEPNLFACRVFTTHQ
DLRFPHIAFFASENVKAGEELGFNYGDHFWEVKGKLFSCECGSSKCKYSSVAMATTPEDQ
QQPSALPDTSSSSGAS
NT seq 3831 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaagcagcccgctggtttagccgtggaaaacgttgcacctccaaagaaagag
ggactggatccaccgaaacatggagaggagaagtcagacgaggacaaagacgtagcatca
gcagcgggacgcgcctctccggccgcggcggaggccatcatgcttaacggcgcggaaagc
gaagacggcagcagacacgcggacctggcggttagcggcatcaagacggcggtgaatgaa
aacggcacagcagagacggagacgccgcacggatccgtaactggaagcaatgggttcatc
ctggctaaggagcagcagcaggacggcgacgcggcgcccgcttcgggggtttcttcccct
ctcaggactaacaggctgccttcgggcggctcgccgtcaggggggcagacagccaaaccc
ctcaacgccacggcggcggtggcgggatgcgcccagagttcaggcgctttaaggaccgac
cccggcacggggaatatgttggacgctaaaaacggctttgcttcaagtcccgtcacgatt
ccgccgcctgttactgttcacagagcgaggaagaccatgtcgagaccggcggtcagcccg
gcgcagaagctcatcaacaaggagctgagacaagcaaacagtgtcaaatcggattctcca
gtcgcaccggatgtgcagaagtcgtctccgccgccgccggctcctgcgcagaaccatcta
cctcagagtccaccagaaacgccagcttcagcacacactgcttcaccagcagctcccaca
gagccggcagctcctgcagattctccagctcctgccaagcttcgcctagggccgtactca
acggtgttttcatcccggaagaagaagaggaggatggggacgtacagcttggttcccaag
aagaaaaccaaagtgctgaagcagagaaccatgctggaaatgtttaaggagctgcagcag
tccgcaaagacccaacagaagagggaggcagccaacgtgaacggggagaaggtggtgaac
gcgtccgaggaagacgagtcggaggacatggagtctgaagaggagacgagaaggcagcct
gcagagcaaacccttccagctgttcaagaaacctctgaatctgctgctcaggtgaaggat
gagcacgagtccgaagactccgaagaagacgagggagaggaggaggaggaaggcacggag
tcggatttgagcttcgagtccagcctgaagaagaaactcaagaagaagtcaaaagcagac
ggcgcctggctcagaccgtccaggaagaggaaacgaaggatgacagccaaagaaccggag
acggatgttctgccccagacgtcgggtcaggagttcacagagatcctcccgtccgagtgc
gtcgacctcagcaagtcgtcgcacagcagcgaaccttccgggtcggccatcgaggaggcg
caggagctgccgctctgcagctgccgcatggagacgccgaaaagccgcgagattctgatc
ctggcggacaggaagtgcatggcgacggagagcgtggacggccagctgacgcgctgccag
ggcgccgtcctgaagcacgagatgatgcgtccgtccaactcggtccagctgctggttctg
tgcgaggatcaccgcagcggcatggtgaagcaccagtgctgccccggctgtgggttcttc
tgcagagctgggacgttcatggagtgccagccggacgtcagcatctcccaccgcttccac
caggcgtgcgcctcgatgctgaagggtcagagtttctgtccgcactgcggggaggaggcc
gccaaggccaaggaggtcaccatcgccaaggccgacaccacatccaccgttcctccggcg
caggccaagggcccggcgacaccaggggctcctgagggccgagcagacacaacgaccgac
agctcttcctgtttgtctcctgtggctgaaatcagcggccgagccgacagctcgctgtcc
gcccatcccgctccggacccggatgacccagccatcccagggtcgtcccgccagccatct
ttgcagtctggaatcggaacgatagcgccacctactctgcccttaggaacaactaaagaa
actctggagagtgtcctggtcgccctggatacggagaaacccaagaagctgcgatttcac
cccaagcagctgttcctgtcggccaaacagggagagctgaagaaggtggtgctcatgctg
gtggacggtaccgacccaaacttcaagatggactcccagaacaaacgcacgccgctccac
gccgccgctgagggaggctacgccgacatctgccacatgctggttcaggccggagcgaac
ctggacatgtgcgacgaagaccagcggacgccgctgatggaggcgtgtgagaacaaccac
atggaggtggtgctgtacctgctgcgggccggagccagcgccatgcacaaggatgttgaa
gggttcacatgtctccacctagcggccaagtctggtcattacagcgtggtggagcacctt
ctgtccactgggctggtggacgtcaactgtcaggatgatggcggttggacagccatgatc
tgggccaccgagtacaaacatgtggaccaggtgaagctgcttctgtccaaaggagccgac
atcaacatcagggataaggagaaaaacatctgccttcactgggcggcgttttccggcagc
gtggaaatctccgaggttctcctgaacgcccagtgtgacctgcaagccgtcaacgtccac
ggagactctcctctgcacatcgccgcgcgggaaaaccgcctggactgtgtcaagctgttc
ttgtctcgaggagctaatgtgtttctgaagaaccgcgagggagagactcctccggactgc
tgcagccacaactccaaggcctggggcgccttgcatgcacacaagagggagagggacgcc
aaaaatggacggctcaggcagaccgaagagaaactgcttcacagtgacatatctttaggc
caggagcaagtttccattccttgtgtgaactctgtggacagcgagccgatcccagacgac
tacaaatacatcacagaaaactgcgtcacgtcgcccatgaacatcgaccggaacatcaca
cacctgcagtactgtgtttgtaaagaagattgttctaccagcatttgcatgtgtggacag
ctgagtctgcgccgctggtacgacaagagcggctgcctgctgcctgagttttgtcgtgag
gagccgccgctgatctttgagtgcaaccacgcgtgttcctgctggaggacctgcaagaac
cgcgtcgttcaaaacggactcagggtcagactcgaggttttcagaaccggtaacaaaggc
tggggagtccgaaccctgcaggatattccacaggggagcttcgtttgcgagtacgttggt
gagatcatctctgaaggtgaagcagataccagacaaaacgatgcttacctgttcagcctg
gatgataagcctgaagatcagtactgcatcgacgcccgtttctatggcaacatcagccgc
ttcctgaaccacatgtgtgagcccaacctgttcgcctgtcgggttttcaccacacaccag
gacctccggttcccgcacatcgccttcttcgccagcgagaacgtgaaggccggggaggag
ctcgggtttaactacggcgaccacttctgggaagtcaaggggaagctgttcagctgcgaa
tgcggctcctccaagtgtaagtactcgtctgtcgccatggcgacgacgcccgaggaccag
cagcagcccagcgcgctgcccgacaccagctcttccagcggcgcctcctag

DBGET integrated database retrieval system