KEGG   Xiphophorus maculatus (southern platyfish): 102219876
Entry
102219876         CDS       T02923                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04020  Calcium signaling pathway
xma04144  Endocytosis
xma04510  Focal adhesion
xma04540  Gap junction
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102219876 (pdgfra)
   04020 Calcium signaling pathway
    102219876 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102219876 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102219876 (pdgfra)
   04540 Gap junction
    102219876 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102219876 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102219876 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:xma04090]
    102219876 (pdgfra)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102219876 (pdgfra)
Protein kinases [BR:xma01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102219876 (pdgfra)
CD molecules [BR:xma04090]
 Proteins
  102219876 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set C2-set_2 Herpes_gE
Other DBs
NCBI-GeneID: 102219876
NCBI-ProteinID: XP_023195321
LinkDB
Position
9
AA seq 1457 aa
MDSVRMYLVCGVAIVLMVSVTPGLSAPTIWPAGDELVLEPHSIINVSCTGQSEVVWEEPP
ADDAVVTSNGFTSALLIYDATVEHTGYYGCRHKNKEGDQNDLVEIYVLVKDPQVVFVPER
AEELLVPYEVDLIIPCRVTAKTHDVELIRVPGGEKLHRYYDYRVGFMGDLSPGQYRCEAT
FKGQTFQSDIYTVISLGSTEVRDFEVEVKASAETVRVGEPFNVSCIGPSGPAFHQQWIHL
KTQAVNAIQTTESLPDSVIYTLNVPRAAAQDGGRYECSVRHEASGKTRVSSVAVAVFGGN
SFVTLDHRGILQMESVGILAETQYTIYINAYPAPKVSWMKDGQALSENYYISSKTSHMEG
NRYQSIVTFRQPMEKDSGNYTITAISGSRTAQFSFILQVAGSTRLNLRPSFPPILLPDED
EVVVPLHEPFTLTCRGGAKLMWETPYDMLEQSQEDNSGLFVTTIAVDEATAMHTGYYVCL
YNDHTAEETKTSSIYVYVSDPDSLFVPNFINHVPVDQNEIEIPCRVSDPSAIVTLVNVDT
NQTVPSDYDSKKGALGIFPTGTYVCKAIINGKEHTSEQYIVHDSIDVLHVELSAKRTAFL
VGDTITVNCLAQGPYLLEDNWKYPGKPANRGTKTVRENKNEGQILYTLTIPQASTKDSGI
YSCSITAVASRDTQTKEIAIQVFAGEFLSIKPEFRDHESAELDDVREFIATISSFPDAHV
TWLKDGVPLSDLIAEISTSLKQTSETSYRSILTLIRVREEDSGNYTLRVENGNQSHEISL
NLVVKVPAVIVDLMDIHHGSATGQSAVCITRGQPTPVVEWFICKNIKQCANDSSFWAPLP
TNSTEITMESHFDEESNLESQVMFGHLKSTLAVRCLAKNEIGAVSREIKLVSNGPHPELT
VAAAVLVLLVIIIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRW
EFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELK
IMTHLGPHLNIVNLLGACTKSGPIYIITEYCFHGDLVNYLHKNRESFLSPSPEKNKKELD
IFGINTADENSRSYVILSFECKGDYMDMKQADNTQYVPMLEMSTTSKYSDVQGSDYDHPP
SQKDSGESDNLLSDDMSEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDLAARNVLLSQGK
IVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTSLSDVWSYGILLWEIFT
LGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPQDVYEMMMKCWNTEPEKRPSFMGLSENV
ASLLPSSYKRHYEKVNHDFLKSDHPAVTRVCIETEADYVDIPYKNQGKLKDRESGFDEQR
LSSDSGYIIPLPDLDPISDDDYGKRNRHSSQTSEESAIETGSSSSTYAKREGETLEDITL
LDEMCLDCSDLAEDSFL
NT seq 4374 nt   +upstreamnt  +downstreamnt
atggacagcgtgaggatgtacctggtctgtggcgttgctattgtgttgatggtttcagtt
acgcctggactgtccgcccccaccatttggccagcaggagacgagctggtgctggagccc
cactccatcatcaacgtcagctgtacgggccaatcagaagtggtctgggaagaacctccg
gcggacgacgccgtcgttacttcaaacggtttcacctcagctctcctcatttacgacgcg
acggtcgagcacaccggctattacgggtgcaggcataaaaacaaggagggcgaccaaaac
gatctggtggaaatctatgtcctagtcaaagatcctcaggtcgtgtttgtcccagagaga
gcagaggagctgctcgttccctacgaggttgatttgatcatcccatgccgagtgacggca
aagacccacgacgtggaactgatccgagtccccggtggagagaagctccacaggtactac
gactacagagtgggcttcatgggcgacctctctcctggccagtacaggtgtgaggccaca
tttaaaggccagactttccaaagtgacatctacaccgtaataagtctgggatccacggag
gtgagagactttgaggtggaagtcaaagccagcgcggagacggtgcgagtcggggagccc
tttaacgtctcctgcatcggaccctctggcccagccttccaccagcagtggatccatctg
aaaacacaggctgtaaatgcgattcagacgacggaaagtcttcctgactcggtcatctac
actctgaacgtcccgcgagccgccgctcaggacggcggccgctacgaatgctcggtcagg
cacgaggccagtggaaaaaccagggtgagcagcgtggctgtggctgtgtttgggggaaac
tcctttgtcaccctggaccacagagggattctgcagatggagtctgttggcattctggca
gagacgcagtacaccatctacattaatgcatacccggctccgaaagtgtcatggatgaaa
gacggccaagcactgtcggagaactactacatttcttccaaaactagccacatggaagga
aatcggtatcagagcatcgttacgttccggcagcctatggagaaagacagcggaaattac
acaatcacagccataagtggctctcgcaccgcccagttctcatttatcctccaagtggca
ggttccactagacttaacctcagaccgtccttcccccctatcctgctaccggacgaggat
gaggttgtcgtccctctccatgagccgttcacgctgacgtgtcgcggaggtgcgaagctg
atgtgggaaacaccgtacgacatgctggagcaatcgcaggaggacaacagtggccttttc
gtcaccaccatcgctgttgacgaagccacagcgatgcacacaggttattacgtttgcctc
tacaatgaccacactgcagaggaaaccaagaccagcagtatttacgtctatgtgtcagat
cccgactctctgttcgtgccaaatttcattaaccatgtgccggttgaccaaaatgagatc
gagattccctgcagggtgtctgatccaagtgctattgtgaccctggtgaatgttgacacc
aaccaaaccgtacctagtgattatgacagtaaaaagggcgctttgggaatatttcctact
ggaacgtatgtctgcaaggccatcatcaacggaaaggagcacaccagtgagcaatacatc
gtccatgattccatagatgtcttgcacgtcgagctgtctgccaaaagaactgcctttctg
gttggagacacaataactgtcaactgcctggctcaaggaccttatttactggaagacaac
tggaaataccctggcaaaccggctaatcggggtaccaaaactgtacgggaaaataagaac
gaaggccagatcctgtacaccttgacaatcccacaagcctcaaccaaagacagcggcatc
tactcctgctccattaccgctgtagcgtctagagacacccagacaaaggaaatagctatt
caagtgtttgccggtgagtttttgtccatcaagccggagtttcgggaccacgaatctgct
gagctggatgacgtccgggagttcattgccacaatttcctcctttcctgatgcccatgtt
acttggctcaaggacggcgtcccgctcagcgacctgatcgctgagatctccaccagtttg
aagcagaccagtgagaccagctacagaagtattctcaccctgatccgggtcagggaggag
gacagtgggaactacaccctgcgggtggagaacggaaaccagagccatgaaatcagctta
aacctggtggttaaagtgcctgcagtcatcgtggacctcatggacatccaccatggttcc
gctacaggacagtctgcagtgtgcattaccagggggcagcctactcctgttgtggagtgg
ttcatatgcaagaacatcaaacaatgcgccaatgactcgtctttttgggcgcctctaccc
accaactcaacagaaatcacgatggaatcccacttcgatgaggagagcaacctggagagt
caggtcatgtttggccatctgaaaagcactctggctgtgcgatgccttgccaagaatgaa
ataggagctgtcagcagggagatcaaattggtgtccaatggccctcaccctgagctgacg
gtagctgctgctgtgctggtgctcctggtcattatcatcatctcactcattgtcttggtt
gttatctggaagcagaaaccacggtacgagatccgctggagggtcatagagtctgtgagt
ccagacggtcacgagtacatctatgtggaccccatgcagcttccctacgactccagatgg
gagtttccccgagatagacttgtgcttggccggatcctgggctctggagccttcgggaag
gtggttgagggcactgcctacggactcagtcgctctcagcctgttatgaaggtggcagtg
aaaatgctgaaacccacggctcgctccagtgagaagcaggctctgatgtctgagctgaag
atcatgactcacctcggaccccatctcaacatcgtgaacctcctgggagcgtgcaccaag
tcaggccctatctacattatcaccgagtactgcttccacggcgacctggtcaactatctg
cacaagaacagggagagcttcctcagcccgagtccagagaaaaacaagaaggagctggat
atctttgggatcaatactgcggacgagaacagcaggagttacgtgatcctgtccttcgag
tgtaaaggagactacatggacatgaagcaggcagacaacacacagtatgtgcccatgctg
gagatgagcacgacctccaagtactctgacgtccagggatccgactacgaccaccctcct
tcacagaaagactcaggcgaatccgacaacctgctgtcagacgacatgagcgaaggcctc
acgaccaccgacctgctcagcttcacctaccaggtggccaaaggaatggagtttcttgcg
tccaaaaattgcgtgcatcgggaccttgcagccaggaacgtccttctctctcagggcaag
attgttaagatctgtgactttgggctggccagagacatcatgcatgacaacaactatgtc
tccaaaggaagcacctttttgccagtgaagtggatggccccggaaagtatttttgacaac
ctgtacaccagtcttagcgacgtttggtcatatggcatcctcctctgggaaatattcacc
ctaggtggcactccgtacccagggatggtggtggattccagcttctacaacaaaatcaag
agcggatacaggatgtcaaaacctgagcacgcgccgcaagatgtgtacgagatgatgatg
aagtgctggaacacagagccggagaagaggccttccttcatgggtctgagtgaaaatgtg
gcgtctttgctgccctccagctacaagaggcactatgagaaggtgaaccacgattttctg
aagagcgaccatcccgccgttacccgagtctgcatcgagacggaagcggactacgtcgac
attccctacaagaaccagggcaagctaaaggacagggaaagcggcttcgacgagcagcgg
ctgagctccgacagcggctacatcatcccactccctgacctggaccctatatctgatgat
gactacggaaagaggaacagacacagctctcaaacgtctgaggagagcgccattgagaca
ggctccagtagctccacctacgccaagcgcgagggcgagaccctggaggatatcacgctg
ttggacgagatgtgtctggactgtagcgacctggccgaggacagctttctgtga

DBGET integrated database retrieval system