KEGG   Xiphophorus maculatus (southern platyfish): 102219886Help
Entry
102219886         CDS       T02923                                 

Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00270  Cysteine and methionine metabolism
xma01100  Metabolic pathways
Module
xma_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102219886
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xma03032]
    102219886
   03036 Chromosome and associated proteins [BR:xma03036]
    102219886
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     102219886
DNA replication proteins [BR:xma03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    102219886
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102219886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP GIDE
Motif
Other DBs
NCBI-GeneID: 102219886
NCBI-ProteinID: XP_005799348
UniProt: A0A3B5QH09
LinkDB All DBs
Position
19
AA seq 989 aa AA seqDB search
MPSNTVTNSNSISCKGSDFVDSPGNRMGESVLLDVGQMKEPRSTFSSASFKVGKPGRKRK
QFPVESCGSITGCASVCNSYLELCRPSISQVYNGETDSRGDKTPDACFPRQEKREVENGI
PRCPSSYQEEDGSQGQSPSPSQENGFLSSQEDRELEKDKDDGLMMPRKKRGRRKLERPTK
YVEHKEDDGCDTIKTEGGRGRLRRGVGWEISLRQRPMPRITFQAGDPYYISKRTREELMA
KWKMEAEKRAKLMSEINIMKDLEKNDAESRTEELPITKHPQPSKQQPQPQPHSQPLPQPQ
YQQQSQPPLPQQKQQQQQQQHKQPPQQQQPTDPASPTVATTPEPVAIGGEEKTSQKSSDT
EPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWSVTGRSRAAEGTRWVMWFGDGKFSVVC
VEKLLPLSSFNNAFHQPTYNKQPMYKKAIYEVLQVASSRAGKAFIACPDSDESETSKSVD
MLNKEMIEWAMTGFQPTGPKGLEPPEEERNSEVYPEMWVEPEAAAYTPPPAKKPRKSTVE
KPKVKDIIDERTRERLVYEVRQKCRSLEDICISCGSLNVSLEHPLFAGGMCQSCKNCFLE
CAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGQGAAHAAIKEDPWNC
FMCSPKGVFGLLERRSDWPDHLQLFFANNHDQDFDPPKLYPPVLVEKRRPIRVLSLFDGI
ATGLLVLKELGIQVDRYVASEVCEDSITVGMVRHQGRIMYVGDVRSVTRKHIQEWGPFDL
VIGGSPCNDLSIVNPARKGVYGGSGRLFFEFYRLLHEARPKEGDDRPFFWLFENVVAMGV
SDKRDISRFLECNPVMIDAKEVSAAHRARYFWGNLPGMNRPLSAMCSDRLDLQDCLEHGR
TAKFEKVRTITTRSNSIKQGKDQHYPVYMNEKEDILWCPEMERVFGFPVHYTDVSNMSRL
ARQRLLGRAWSVPVIRHLFAPLKDYFACV
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgccatccaacactgtcaccaactccaactccatctcatgcaaaggctcggatttcgtg
gattcacccggaaacagaatgggtgagagcgtattactggacgtgggacaaatgaaggag
ccgaggtcaacgtttagcagtgcctcctttaaagttggaaaacctggaaggaagcgtaag
cagttcccagtcgagagctgcggatccatcacgggctgcgcgagcgtttgcaacagttac
ctcgagctgtgccggccatccatatcgcaagtctacaacggagaaaccgactcacgcgga
gacaagacgcccgacgcctgcttccccagacaggagaagcgggaagtggagaatggaatt
cccagatgcccgtcctcctaccaggaggaggacggctcccagggtcagagccccagtccc
tcccaggagaacggcttcctgtccagccaggaggaccgggagctggagaaagacaaggac
gacggcctgatgatgccgcgcaagaaaagagggaggcggaaactggagcggccaacgaag
tatgtggagcacaaggaagacgacgggtgtgacacaatcaagactgagggaggtcgaggc
aggctacgaaggggagttggttgggagatcagccttcgacagaggccaatgcccagaata
accttccaggctggtgacccttattacattagcaagcggaccagggaggagttgatggcc
aagtggaagatggaggcagagaaaagagccaagctaatgtcagagatcaacataatgaag
gacctggagaagaacgacgcagagagccggacagaggagctcccaataaccaaacacccg
cagccttcaaagcaacaacctcagcctcagccgcacagccagcctctgccgcagcctcag
tatcagcagcaatcacagccgcctctgccgcagcaaaagcagcagcagcagcagcagcaa
cacaagcagccgcctcaacagcagcaacctactgacccggcttctcccactgtggccacc
actccggagcctgtcgccatcggaggagaggaaaaaacttcccaaaagtcttcagacact
gagcccgagtatgaggacggccgtggttttggcatcggcgagctggtttgggggaagctg
cgaggattttcttggtggccaggccgcatcgtatcctggtctgtgacgggccggagcaga
gccgccgagggaaccagatgggtcatgtggtttggagacgggaaattctcagtggtatgt
gtagagaaacttctgcctttaagttcatttaataatgcctttcaccaaccaacttacaac
aaacagcccatgtacaagaaagcaatctacgaagtgttacaggtggctagtagccgggca
gggaaagccttcatagcctgccccgacagcgatgaaagtgaaacctccaaatcagtggac
atgttaaacaaggagatgattgagtgggcgatgaccgggtttcagcccactggacctaag
ggcttagagcctcctgaagaggagcgtaactccgaggtttaccccgagatgtgggtggag
cccgaagcggcggcctacacgccccccccagccaaaaagcctcgcaaaagcacggtggag
aaaccaaaagtcaaggacatcatcgatgagaggacacgagagcgacttgtttatgaagtg
agacaaaagtgccgcagcttggaggacatctgcatctcttgtggaagtctgaacgtgagc
ctggagcacccgctgttcgctggaggaatgtgccagagctgcaagaactgcttcctggaa
tgtgcgtaccaatacgacgatgacggttatcagtcgtactgcactatttgctgcggcgga
cgtgaggtgctcatgtgtggaaacaacaactgctgcaggtgtttctgtgtggaatgtgta
gacctcctcgtcggtcaaggagccgcccacgctgccatcaaagaggacccgtggaactgc
ttcatgtgcagtccgaagggcgtgtttggccttctggagcgccgctcagactggcccgac
catctgcagctcttcttcgcaaataatcatgaccaagatttcgatccaccaaagctttat
cccccagtcctggtggagaagaggaggcccattcgtgttctgtcgctgtttgatggcata
gcaacaggactgctggtgttaaaagaacttggcatccaagtggatcgctacgtagcgtcc
gaggtgtgtgaagactcaatcacagtgggcatggtccgacatcaggggcggatcatgtac
gttggggatgtgaggagtgtcacacgcaaacatattcaggagtggggtccgtttgacctc
gtcattggtggaagtccctgcaacgacctctcgatagtcaatcctgctcggaagggcgtt
tatggaggcagcggccgcctcttctttgagttctaccggctgctccacgaggctcggccg
aaggaaggagacgacagaccgttcttctggctctttgaaaacgttgttgcgatgggtgtg
agcgacaagagggacatctctcgctttttagagtgtaatccagttatgattgatgccaag
gaggtgtctgctgcccaccgcgcccgttacttttggggtaacctccctggcatgaacaga
cctctgtcggccatgtgctccgacaggctggacctccaggactgtttggagcacggcaga
acggcaaagtttgagaaggtgaggaccatcaccaccaggtctaactccatcaagcaaggg
aaggaccagcattatcccgtctatatgaatgaaaaagaagacatcctctggtgccctgag
atggaaagggtattcggcttcccagtccactatacagacgtttccaacatgagccgactg
gcgaggcagaggctcctgggccgagcgtggagcgtccccgtcatccgccacctgtttgca
ccacttaaagattactttgcctgtgtttga

DBGET integrated database retrieval system