KEGG   Xiphophorus maculatus (southern platyfish): 102220398
Entry
102220398         CDS       T02923                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102220398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102220398
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xma03310]
    102220398
Transcription factors [BR:xma03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102220398
Nuclear receptors [BR:xma03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102220398
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 102220398
NCBI-ProteinID: XP_005795391
Ensembl: ENSXMAG00000009167
UniProt: M4A402
LinkDB
Position
23
AA seq 767 aa
MDQGGVKKIAYRRNDHLSKLVYTESPEEGGLLKVAPHSAMSITSPPSVVLPSSPLMQPGQ
VTNGLSNSPLPEELASAPATIGSSVDSSETRGLTKDQRPEELQLFQTQTFNTFGHQVLPQ
LDASMADITQSSMDSLIGGSDPNLFAVKTEDFSMDKSEQDPNDLDHAFDHIGKDVDMNQK
LFNETSLDLLQEFDLTASPSDFYVGDDDAFLSTLADDSLLADGEMRGTTERDVKPSVVES
VGTTRVCDSSKASSPLESKSKTPSLTPTTTFPAVVKKEKDTGFIQLCTPGVIKKEKTSSG
YCQMSGSSPISICGVSTSGGQSFHFGINARNNDALQEKDQKPVSGLFLPVTTISGAWNRN
QGDNSAIRRASEIFSSSPSFSSSFASSISRQEGGTPTSTTQGKSGTHKICLVCSDEASGC
HYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEAR
KTKKLNRLKGNQNSNPPEMMPSPPVEARSLVPKCMPQLVPTMLSLLKAIEPDTIYAGYDG
TLPDTSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFGLGW
RSYQQCNGNMLCFAPDLVINEERMKLPYMAEQFEQMLKISSEFVRLQVSHDEYLCMKVLL
LLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMHEMGS
GLLSFCFYTFVNKFLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQK
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggatcaaggtggagtgaagaagatagcgtacagaagaaatgaccatctaagcaaactg
gtctacactgaaagccctgaggagggaggtcttctaaaggtggctcctcacagtgccatg
tccatcacctctcctccttctgttgttcttccatccagcccattaatgcagcctggacag
gtgaccaacggcctcagcaacagcccacttccagaggagcttgcctcagcccctgccacg
atcggttcctcggttgacagttcagaaaccaggggcctgaccaaagatcagaggcctgaa
gagctacagttgttccaaacgcagactttcaatacttttgggcatcaggtcctgccccag
ttggatgccagcatggcagacattacccagtcctccatggactccctcatcggggggtcg
gatcccaacctatttgctgtgaaaacggaggatttctccatggataaaagcgagcaggac
cccaacgatctggaccatgcctttgaccacattggcaaagatgtggacatgaaccagaaa
ctgttcaacgaaaccagtctggatctccttcaagagtttgacctcaccgcatccccctcc
gatttttacgttggggacgatgatgcctttttgtccacgctggcagacgattctttgctc
gcagacggggaaatgagagggacgactgagagggacgtgaaaccctccgtggttgagagc
gtcggcaccaccagagtctgcgacagcagcaaggcatcaagcccacttgaatccaagtcc
aagactccttctttgacccctacaaccacttttcccgccgtggtgaagaaagaaaaagat
accggcttcattcagctctgcacaccaggcgtgattaagaaggagaagacgtcttcgggg
tattgtcagatgagcggctcaagccccatctctatctgcggggtgagcacttcagggggc
cagagcttccactttggaatcaacgccagaaacaacgacgctctgcaggagaaggaccag
aaacccgtgtctggcttgttcctcccagtaacgaccatcagtggagcctggaaccggaac
cagggcgacaactcagcaatccgcagggccagtgagattttctcaagctctccctccttc
tcctccagctttgccagttccatctccagacaggaagggggcactccaacatccacgacc
cagggaaagagcgggactcataaaatctgtctggtgtgctctgatgaggcctcggggtgc
cattatggagtcctcacatgtggcagctgcaaggtcttcttcaagagagcagtggaaggc
cagcataattacctgtgtgctgggaggaacgactgcatcattgacaaaatcaggcgaaag
aactgcccggcctgccgcttccgcaaatgcctgatggcaggcatgaacctggaagctcgc
aaaacgaagaagttgaatcgcttaaagggcaaccagaacagcaacccgccagagatgatg
ccttcgccgccggtcgaggctcgctcgctggtgcccaagtgcatgcctcagctcgtcccc
accatgctgtccctgctgaaggccatagagccggacaccatctacgccggctacgacggc
acgctccccgacacgtccacgcgcctcatgaccacactgaacaggctgggtgggcgacag
gtcatctctgccgtgaagtgggccaaagctctgccaggtttcaggaacctgcacctggat
gatcagatgaccctgctgcagtgctcctggctcttcctcatgtctttcggcctgggctgg
aggtcttaccagcagtgcaacggcaacatgctctgcttcgcaccagacctcgtcatcaat
gaggagcggatgaagctgccctacatggccgagcagtttgagcagatgctgaagatttcc
agcgagttcgtccggctgcaggtttcccatgatgagtacctgtgcatgaaggtcctgctg
ctgctcagcacagtgcccaaggacggcctgaagagccaggcggtgttcgacgagatccgc
atgtcgtacatcaaagagctgggaaaagccatagtgaagcgcgaggagaactccagccag
aactggcagcgtttctaccagctcaccaagttgttggactccatgcacgagatgggcagc
ggactgctcagcttctgcttctacacctttgtgaataaattcctgagcgtggagttcccc
gagatgctggccgagatcatcagcaatcagctaccaaaattcaaggctggaagcgtcaaa
cctctcctcttccaccagaagtga

DBGET integrated database retrieval system