KEGG   Xiphophorus maculatus (southern platyfish): 102220806
Entry
102220806         CDS       T02923                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102220806 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102220806 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xma04052]
    102220806 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:xma00536]
    102220806 (fgf1)
Cytokines and growth factors [BR:xma04052]
 Growth factors
  Growth factors (RTK binding)
   102220806 (fgf1)
Glycosaminoglycan binding proteins [BR:xma00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102220806 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102220806
NCBI-ProteinID: XP_005805501
UniProt: M3ZH55
LinkDB
Position
11
AA seq 167 aa
MGGLSSCFRSAPPRPEQSGGEHIAQPPSLQQSQDLSFLPERRSRVKLYCQTGGYHLKIAE
DGTVSGVREEDDPYVIMKLKSVGVGLIVIQGVQSLKYLAMNQKGDLFGKDSPTDDCNFLE
HIEPNGYTTLRHEEYSWYVGMKANGTPMKGTETHQGMKNILFLPRPA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggggggcctctcttcttgtttccggagcgctcctccacgtcccgagcagagtggtggg
gagcatattgctcaacctccgtctttacaacagagccaggatcttagcttccttccggag
agacgctcgagagtcaagctctactgtcagactggaggatatcacctgaagattgcagaa
gatggaacagtgtctggtgtgagggaagaagatgacccctatgtaatcatgaagctgaag
tcggtgggtgtaggacttattgtcatccagggggtgcagtcattgaagtacctggctatg
aaccagaaaggagacctcttcggaaaagatagcccgactgatgactgtaacttcttggaa
catattgaaccaaacggctacaccacacttcgccacgaggaatactcctggtatgttggt
atgaaggcgaatggcacacctatgaagggaacagaaacccaccagggcatgaagaacatt
ttattcctgccgagaccagcctaa

DBGET integrated database retrieval system