KEGG   Xiphophorus maculatus (southern platyfish): 102221028
Entry
102221028         CDS       T02923                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102221028
   04068 FoxO signaling pathway
    102221028
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102221028
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102221028
NCBI-ProteinID: XP_023205955
LinkDB
Position
17
AA seq 174 aa
MCNNMSDVRLSNASPTVERVDARPPDNARSVRRVLFGTPDPEETRKQAEALQRQSVEAFR
DTYNFDPVEDRPLSPGLYDWQEDEDAPEFYRRPPRGSQPPRGEAGEGSPETRRERRSAHT
NGSRKRSSESAGHCSDDCTSNGKKSRSDKDDDEEQALGAGSQAEQQQEEEEVPC
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcagacgttcgcctctctaacgcgagccccacggtggagcgggtg
gacgcgcggccgccggacaacgccaggtcggtccgcagggtgctgttcggcacacctgac
ccggaggagacgcggaagcaagcggaggctctgcagcggcagtccgtggaggcttttagg
gacacgtacaacttcgacccggtggaggacaggccgctctctccggggctctacgattgg
caggaggacgaagacgcgccggagttttaccgcaggccgccgcgggggagccagccgccc
cggggcgaggcaggcgaaggcagcccggagacgaggagggagaggcggtcggctcacact
aacggttcgcggaaacgatcttcagaatctgcaggtcattgctctgacgattgcacgagt
aacggcaagaagtcgcgttccgacaaagacgacgatgaagagcaggcgctcggtgcagga
agccaggcagagcagcagcaggaggaggaggaggtcccatgctga

DBGET integrated database retrieval system