KEGG   Xiphophorus maculatus (southern platyfish): 102221242Help
Entry
102221242         CDS       T02923                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    102221242 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102221242 (ace)
   04090 CD molecules [BR:xma04090]
    102221242 (ace)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102221242 (ace)
Peptidases [BR:xma01002]
 Metallo Peptidases
  Family M2
   102221242 (ace)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102221242 (ace)
CD molecules [BR:xma04090]
 Proteins
  102221242 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 102221242
NCBI-ProteinID: XP_014329010
Ensembl: ENSXMAG00000014511
UniProt: M4AJE2
LinkDB All DBs
Position
10
AA seq 1290 aa AA seqDB search
MGAMVPEARRLLRAALLLLPALLLLCEALPAAWLPGDYVDSVDDAQRFLGDYNSTAEEVS
FYSVSASWNYNTNLTEHNSKLQVAASLEEQAFVEAWGGKAKQVFSLDTLNSLSTADKKLI
EKIKSLGAANLPQAEREEYNTILSTMDSIYSTAKVYPEPDISWSLEPELTEILANSRSYK
KLLFAWEGWHNASGVPLKEHYPRFVELSNNASKLDGFNDTGADWRSWYETETFQQDLENL
YKTIEPLYLNLHAFVRRKLYNFYGPKYINLKGPIPAHLLGNMWAQAWNNIYDMMIPFPDK
PNLDVTNEMVKQGYNATHMFRVAEEFFTSLGLKEMPPEFWDGSMLVKPEDREVVCHASAW
DFYNRRDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPIGYRRGANPGFHEAIGDVM
SLSVSTPKHLHEINLLESVTTDAETDLNFLLKTALEKIAFLPFGYLIDLWRWGVFSGSIP
PEKYNSEWWYLRTKYQGICPPTSRTEEHFDPGAKYHIPGNTPYIRYFVSFILQFQFHEKL
CEAAKHTGPLHTCDIYRSAEAGEILRNVLEAGSSKPWPEVLQEAIGTNKMNAASLMKYFD
PIIKWLEQQNVNETLGWPEFNWVPPIPEGYPEDIDKNTDELHAKQFLDEYNSTVEIVWNA
YTEANWKYNTNITGANNQEVLKKDLEMAAHTLEYGLKARQYDTSDFQDPSVKRIIKKLSD
LEKAALPTAELEELNNIMSNMETKYSVAEVCRENGKCHPLDPDLQRIMAESRDYDELLFA
WKGWRDAAGKVIRDDYKRYVELANKAATLNGHSDNGAFWRSLYETPTFEEDLEALWKELE
PLYLNVHAYVRRALYKKYGSDSINLKGPIPAHLLGNMWAQTWSGIMDLVMPYPDATQVDA
TPAMVSQGWNATRMFQESDRFFTSLGLLPMPQEFWDKSMLEKPTDGRQVVCHASAWDFFN
RKDFRIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRTGANPGFHEAIGDVLALSV
STPKHLQSIGLLDKVESNHESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPSSDY
NKEWWNLRLKYQGLCPPVTRTEDDFDPGAKFHVPASVPYVRYFISFVIQFQFHKALCDAA
KHDGPLHTCDIYRSKEAGKLLGDVMRLGYSKPWPEAMAMITGQSKMSVQPLMQYFQPLIT
WLEEENKKNNEVRGWPDYNWRPSDPDVATNDEKVEFLGLKVDKAAAKAGQWLLLSISLAF
LVVIIQLAYKYRKSKKRNKSLSMMELKQKD
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatggttcccgaggcgcgcaggctgctgagagcggcgctgctgctgctgcca
gccctgctgctgctgtgtgaagctctgccagccgcctggctgccaggggactatgtcgac
tcagtcgatgatgcccagaggttcctcggtgactacaacagcaccgcagaggaggtgtcc
ttctacagcgtgtccgccagctggaactacaacaccaacctgacggagcacaactccaag
ctgcaggtagctgcaagtctagaagaacaagcctttgtagaggcctggggggggaaggcc
aagcaggtcttctctctggataccctgaacagtctttctacagccgacaagaaactgatt
gaaaagatcaagtcactgggagctgccaaccttccacaggctgaacgagaggagtataac
accatcctgagcaccatggacagtatttattcaacagctaaggtgtacccagagccagac
ataagctggagcctggaacctgaactcacagaaattctggccaactccaggagttataag
aagttactgtttgcttgggaaggctggcacaatgcatcaggtgtgcctcttaaggagcat
tatcccaggtttgtggagctcagcaacaacgcctcaaagctcgatggctttaatgacact
ggggctgattggcgctcttggtatgagaccgaaacctttcagcaggatttagagaatctc
tacaagacaattgaaccgctctacctgaacctgcatgcctttgtgcgacgcaaactctac
aacttctatggacccaaatatatcaacctaaagggacccatccctgcacacctattggga
aatatgtgggcccaggcgtggaataacatttatgatatgatgatcccatttcctgacaaa
cccaacctggatgtgaccaacgagatggtcaaacagggctacaatgccacacacatgttc
cgtgtggccgaggagttcttcacctctctgggtctgaaggagatgcctccagagttctgg
gacgggtcgatgcttgttaagcctgaagatcgggaggttgtgtgccatgcgtctgcctgg
gacttttataaccgcagagacttcaggattaagcagtgcaccacagtaaccatggaacag
ctcttcactgtgcaccatgagatgggccacatccagtattacctgcagtacaaggatcag
cctataggctaccgccgtggagccaaccctggtttccatgaagctatcggtgacgttatg
tccctgtcagtttcaacacccaagcaccttcatgagatcaaccttctggagtctgtgacc
accgacgcagaaactgatctgaacttcctgttgaagaccgctctggagaagatagccttc
cttccctttggctacctcattgacctctggagatggggcgtgtttagtggaagcattcct
ccggagaagtacaactcggaatggtggtacctcagaacaaagtaccaaggaatttgccca
cctaccagccgaacagaggagcactttgatcccggagcaaagtatcacattcccggaaac
acgccatacatcaggtacttcgtcagcttcatcctccagttccagtttcatgaaaaactc
tgtgaggcagccaagcacaccgggcctctgcatacctgcgacatctaccgctctgcagag
gccggcgagattctacgaaacgttcttgaagcaggttcctctaagccctggccagaagtc
ctccaagaggccataggcacaaataagatgaacgccgcttctctgatgaaatacttcgac
cccataatcaagtggctggaacaacaaaatgtgaatgagaccctgggatggcctgaattc
aactgggtcccgcccatccctgaaggctaccctgaagatatcgacaagaatacagacgag
cttcatgcaaagcaatttctggatgaatacaacagcacagttgaaatagtgtggaatgcc
tacactgaggccaactggaagtacaacacgaacatcactggagctaataaccaggaagtg
cttaagaaagacctggaaatggcggctcacaccctggagtacggcctgaaggctcgccag
tatgacacctccgacttccaggacccgtctgtcaaacgcatcatcaaaaaactcagtgac
cttgagaaggcagcactgccaactgcagaactggaagagttaaataatattatgtctaac
atggagacaaaatatagtgtggcagaagtttgtagggaaaatggcaaatgtcatccactg
gatccagatctccagagaatcatggcagagtccagggattatgatgaactattgtttgcc
tggaaaggatggagagacgctgctggcaaagtaattcgtgatgattataagagatatgtt
gaactggccaataaggctgccacactcaatgggcattctgataatggggctttctggcgg
tccctgtatgaaacccctacctttgaagaggacctggaggctctgtggaaggaactggag
ccgctctatctcaacgttcacgcctacgttcgaagggctctttacaaaaagtatggctcc
gatagcatcaacttaaaggggcccatccctgctcacttgttgggcaacatgtgggcacag
acatggtctggaatcatggatttagtcatgccctatccagatgccacacaagtcgatgcc
acaccagctatggtgtcacagggctggaatgcaaccaggatgtttcaggagtcggacagg
tttttcacctccctgggtctactgccaatgccacaagagttctgggacaaatccatgctg
gagaagccgactgacggacgccaggtggtgtgccatgcctctgcgtgggatttctttaac
cgaaaggacttcaggataaaacaatgcaccgttgtgactatggacgacctgatcactgtg
caccatgagatgggccatgtgcagtacttcctgcagtacaaagaccagcccgtttcgttc
cgcaccggcgccaacccaggcttccacgaagccatcggagacgttctcgcgctgtccgtc
tccacgcccaaacatctgcagagcatcgggctcctggacaaagtggagagtaaccacgag
agtgacatcaactttttgatgagcatggcgctggacaaaattgccttcctgccttttggc
tacctgatggaccagtggagatggaaggtcttcgacggacgcatcccatcgtcggattat
aataaagagtggtggaacctcagactgaagtaccagggcctctgcccccctgtaacccgc
accgaggatgactttgacccaggcgcaaagttccacgtccctgccagcgtgccatacgtc
cgttacttcatcagcttcgtcatccagtttcagttccacaaagctctgtgtgacgcagct
aagcatgatgggcctctgcacacgtgtgatatctaccgatctaaagaagctgggaagctg
ctgggggatgtgatgcggctcggttacagtaagccgtggccggaagccatggccatgatc
acgggtcagtccaagatgagtgtccagcctctcatgcagtacttccaacctctcatcaca
tggctggaggaggagaacaagaagaacaacgaggtccgcgggtggcccgactacaactgg
aggccttcagatcctgacgttgcaacgaatgatgagaaagttgagttcctgggactgaaa
gtggacaaggccgctgccaaagctggccagtggttactgctgtcaatcagcctggctttc
ctggtggtcatcatccaactcgcctacaagtacaggaagtccaagaagcgtaataagtcc
ttatctatgatggagctcaagcaaaaggactag

DBGET integrated database retrieval system