KEGG   Xiphophorus maculatus (southern platyfish): 102221527
Entry
102221527         CDS       T02923                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102221527 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102221527 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xma03310]
    102221527 (nr3c1)
Transcription factors [BR:xma03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102221527 (nr3c1)
Nuclear receptors [BR:xma03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102221527 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 102221527
NCBI-ProteinID: XP_023197554
Ensembl: ENSXMAG00000019242
LinkDB
Position
11
AA seq 756 aa
MDQGGPKHNGNRNDNLTFAGIRPEVGRDSVSTSGLLLQPTMHLPSPGSVNQSTVAPNGQG
GTKDQGELGGLFESDKEGKMSRMHKQEQDIFSYGDSLSLLNQSTSDLDQTSTSVINTSET
SVLGNLPLPDLFPQQIKQEGIFSLDKELGTYGGQAGVGSCSLDGSTSQLIDDADIWQDLD
LPNSLPEISAFELDSEVAHLDTILQESSSGGEKSLLGNGANCIGLNGTEQQQLVQQHQLQ
QQQPPGMLSSVVIKVEKDPDFIHIRTPGVVKQEKQDGASYCQSQCLQSGMNPLHGVGTIP
SAMGLATGTGYHYRGNPETAGLQDQKPFGTYSNLPGVGESWISGKRYGEASGIQSTSDGL
QSAAALGNFPVSFTSSSARTGENSSTAVTGQSKPGGQAHKICLVCSDEASGCHYGVVTCG
SCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLNKI
KVQTPTRPSEPASSLPMPIIPRSMPQLVPTMLSVLKAIEPEIIYSGYDSTLPDTSSRLMS
TLNRLGGQQVISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGRML
CFAPDLVINEERMKLPLMGDQCEQMLKICNEFVRLQVSYDEYLCMKVLLLLSTVPKEGLK
SQAVFDEIRMTYIKELGKAIVKREENTSQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFV
NKTLSVEFPEMLTEIITNQIPKFKDGSVKPLLFHQK
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggatcagggtggaccaaagcacaacggtaatcggaacgacaaccttacatttgcaggg
atcagacctgaagtaggcagagattcagtcagcacatctggtttactgcttcaacccaca
atgcatctgcccagtcccgggtctgtgaaccagagcacagtggcaccaaatggacaaggg
ggaactaaagaccagggggaacttggaggcctctttgagtcagataaggagggtaaaatg
agcagaatgcacaaacaagaacaggatatattcagctatggggacagtttgtctttgttg
aaccagagtacttctgatctcgaccagacgtccacctctgtcattaacacatcagaaacc
tcagtcctggggaacctccctttgcctgacctgttccctcagcaaattaagcaggagggg
attttctctctggataaggaattaggaacttatggtggacaagcaggtgttggttcttgc
agtctggatgggagcacttctcagctaattgatgatgcagatatctggcaagacctggac
cttccgaactctctgccagaaatcagtgcttttgagttggattcagaggtggcacatttg
gataccatcctccaggagagcagcagcggtggtgaaaagtccctgttaggtaatggggcc
aactgtattggtttgaacggcacagagcagcagcagctggtacagcaacatcagcttcaa
cagcagcagccaccgggaatgctttccagtgttgtcatcaaggtggagaaggatcctgac
ttcatccacatccgtacccctggtgtggtcaaacaggagaagcaggacggtgctagttac
tgccagtcccagtgtctgcagagtggcatgaaccctctgcatggggtgggaaccataccg
tctgccatgggtcttgccacgggaactgggtaccactacagaggcaatcctgagacagcg
ggcttgcaagaccagaagccttttggcacatactcaaacttgccaggagtcggggagagc
tggataagcgggaagaggtatggagaagcctctgggattcagagcaccagtgatggcctt
caatctgctgcagctttggggaattttcctgtcagctttacaagctcatcagccagaaca
ggagagaacagcagcactgccgtgacaggccagtccaagcccggtgggcaagcccataag
atctgtctggtgtgctcggacgaggcatcaggatgccattacggggtggtgacctgtggc
agctgcaaagtgttcttcaaaagggccgttgaaggtcagcacaactatctgtgcgcggga
agaaatgactgcatcattgataagatccgcaggaagaactgtccagcatgccgcttcagg
aaatgtctccaggccggaatgaacctggaagcaaggaaaaacaagaagcttaacaagatt
aaagtgcaaacgccgaccaggccctccgaacctgccagcagcctgcccatgcccatcata
cccagaagcatgccgcagctcgtgcccaccatgctgtccgtcctgaaggccatcgagcct
gagatcatctactcgggctacgacagcacgctgccggacacctcatctcgtctcatgagc
accctcaacagactgggaggccagcaggtcatctctgctgtcaaatgggccaagtcgctg
ccaggcttccgtaacctgcaccttgatgatcagatgacgttgctgcagtgctcctggctt
ttcctcatgtccttcagcctcggctggaggtcctatgagcagtgtaacggcagaatgctc
tgttttgctccagatctcgtcataaatgaagagcgcatgaagctgcctttaatgggtgac
cagtgtgagcagatgctgaagatttgcaatgagtttgtccgactgcaggtgtcttatgat
gagtatctctgcatgaaggtcctgctactgctgagtacagttccaaaagaaggcctgaag
agccaggcggtttttgatgagatcaggatgacttacatcaaggagctgggaaaagccatt
gtgaagagagaggagaacacgagtcagaactggcagcggttctaccagctaactaagcta
ctggactccatgcaggagatggtggagggtctcctgcagatctgtttctacacctttgtg
aataagaccctcagcgtggaattcccagagatgctgacggagatcatcaccaaccagata
ccaaaattcaaagacgggagcgtcaaacctctgctgtttcatcagaagtga

DBGET integrated database retrieval system