KEGG   Xiphophorus maculatus (southern platyfish): 102221987
Entry
102221987         CDS       T02923                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
xma  Xiphophorus maculatus (southern platyfish)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 DUF5113 Cut8 DUF5111
Other DBs
NCBI-GeneID: 102221987
NCBI-ProteinID: XP_014331418
Ensembl: ENSXMAG00000016883
UniProt: M4AR36
LinkDB
Position
20
AA seq 365 aa
MSWGEFIELRDLNSGREQIGLAGPRLPCSPPRLERTNALRISPGKVPDLLSRVGIIRVLS
SSQDPQFVEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLRCVNCRFTCHYRCRALI
RLDCSWERGSTADLTAVVEHTIETDTNVDEQIQCEKQELSTAEILQKVKEYNSQINSNLF
MNMNKDGSYTGFVKVQFKLVRPVSVPAPKKGGPDAGGKRASGVKRRTSFYLPKDASKHLH
ISSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYVRKLSDDERPLRLRLNAGPN
EKLLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIVQRYTLARTKMLEALS
GSTPG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgtcttggggcgagttcatcgagctccgggacctgaactccggcagagagcagatagga
ctggcaggcccgcgtttgccctgctctcccccacgcctggagcgaacgaacgccttgagg
atcagcccggggaaggtgccggacctgctgagccgggtgggcatcatccgggtcctgagc
agctcccaggatccccaatttgtggaggagaaaggagagggacacaactttcagccctgc
agccacgctcagccaacttggtgcgacctgtgcggcgacttcatctggggcctttacaag
cagagcctgcggtgtgtcaattgcagattcacgtgccactaccgctgccgtgcgctgatt
cggctggactgcagttgggagcgaggctctacggcggacctcaccgctgtcgtggagcac
acaatcgaaacagacacgaatgtggatgaacaaatccaatgtgagaaacaggagctatca
actgctgaaattctgcagaaagtgaaggaatacaactcccagatcaatagcaatctgttc
atgaacatgaacaaggacgggtcctacactggttttgtgaaggttcaattcaagctagtg
cgccccgtgtcggtcccagcgccaaagaaaggaggtcctgatgctggagggaagcgagcc
agcggggtgaagcgtcgcacctccttctacctgccaaaggacgcctccaagcatttgcac
ataagctcccgtacttctgctcgcgaggtcatcgaggctctgctgaaaaagtttactgtg
gtagacaatcccggcaagtttgcactgtttgagcgcagcgagcgccacgaccaagtttat
gttcgcaagctctctgacgacgagcgtcctctccgtttgcgcctgaatgctggacccaac
gagaagctcctcagttttgttctcaaagaaaatgaaactggtgaagtgaattggcatgct
ttctccatgccagagctgaagaacttcctgctgatcctgcagcgtgaggaggaggagcac
gtcaagcagatcgtacagcgatacactttggctcgcaccaagatgctggaggcactgtcc
ggctcgacgccgggctga

DBGET integrated database retrieval system