KEGG   Xiphophorus maculatus (southern platyfish): 102222003Help
Entry
102222003         CDS       T02923                                 

Definition
(RefSeq) pancreatic alpha-amylase-like isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00500  Starch and sucrose metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102222003
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102222003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 102222003
NCBI-ProteinID: XP_005802012
Ensembl: ENSXMAG00000000523
UniProt: M3ZE80
LinkDB All DBs
Position
6
AA seq 512 aa AA seqDB search
MKFLILVALFGLSLAQHNPHLKSGRTAIVHLFEWRWADIAAECERYLGPNGFGGVQISPP
NEHILVSSPWRPWWQRYQPIGYNLCSRSGSEAELRDMITRCNNVGVNIYVDAVINHMCGS
GGGEGTHSSCGSWFSASKEDFPSVPYSYMDFNDNKCKTGSGEIENYSDPYQVRDCRLVGL
LDLALEKEYVRGKVADFMNKLIDMGVAGFRVDASKHMWPGDVDSIYRRLNNLNTKWFPSG
ARAFIFQEVIDLGGEAISAQEYVHLGRVTEFKYGAKLGTVFRKWNGEKLSFTKNWGEGWG
FMADGNALVFVDNHDNQRGHGAGGASIVTFWDARLHKMAVAYMLAHPYGQARVMSSYRWD
RNIVNGQDQNDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIKNMVIFRNVVNGQ
PHANWWDNQSNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGEKQGSGCTG
KQVQVGSDGRANFYISNTEEDPFIAIHADSKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttctcattctagtcgctctgtttggcctgagccttgctcagcacaatccccac
ctcaaaagcggaaggactgccatcgtccatctgtttgagtggcgctgggctgatatcgct
gcagagtgtgagcgctatttgggtcctaatggcttcgggggtgttcagatttctccacca
aatgaacacattcttgtgagcagtccctggaggccctggtggcaaagataccagccaatt
ggttataatctgtgctcaagatctggcagtgaggctgaactcagggacatgatcaccaga
tgcaacaatgttggggtcaacatctatgtggatgctgtcatcaaccacatgtgcggatct
ggtggtggagagggaacccattcttcctgtggcagctggttcagtgcaagcaaagaggac
tttccaagcgtcccatactcttatatggacttcaatgacaataaatgcaagactggtagt
ggtgaaattgagaactacagcgatccctatcaggtgcgcgactgtcgtctggttggtctg
ctggatcttgcccttgagaaagaatacgtcaggggcaaagtggctgacttcatgaacaag
cttattgacatgggtgtggctggattcagagtggatgctagcaagcacatgtggcctggt
gacgtggattccatctaccgtcgtctcaacaaccttaacaccaaatggtttccaagtggt
gccagagcttttatcttccaggaggtaattgatcttggaggtgaggccatctcagctcag
gagtatgtccatctgggaagagtgactgaattcaaatatggtgccaaactgggaactgtc
ttcagaaagtggaatggggagaagctttctttcactaagaactggggagaaggttgggga
ttcatggctgatggcaatgctcttgtctttgttgacaatcacgacaaccagagaggtcac
ggtgctggtggtgcctccattgttaccttctgggacgccagactccacaagatggctgtg
gcctacatgctggctcatccttatgggcaggccagagtgatgtcaagctaccgctgggac
cgtaacatcgtgaatggacaggatcagaatgattggattggccctcccagtaatggtgat
ggatccaccaagcctgttccaatcaaccctgaccagacctgtggagacggatgggtgtgt
gagcatagatggcgtcagatcaagaacatggtcattttccgtaatgtggtcaatggacag
cctcatgccaactggtgggacaaccagagcaaccaggttgcctttggacgcggtaaccgt
ggtttcatagtttttaacaatgatgactgggccctagatgtaaccctgaacactggtttg
cctggtggaacctactgtgacgtcatttcgggtgagaagcaaggaagtgggtgcaccgga
aagcaggtccaagttggaagtgatggccgcgccaacttctacatcagcaatacagaggaa
gatccttttattgctatccatgctgactccaagctgtaa

DBGET integrated database retrieval system