KEGG   Xiphophorus maculatus (southern platyfish): 102222169
Entry
102222169         CDS       T02923                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like isoform X2
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
xma04115  p53 signaling pathway
xma04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102222169
   04068 FoxO signaling pathway
    102222169
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102222169
   04115 p53 signaling pathway
    102222169
   04218 Cellular senescence
    102222169
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102222169
NCBI-ProteinID: XP_005799932
Ensembl: ENSXMAG00000001096
LinkDB
Position
20
AA seq 156 aa
MAPHKPTLSSLGGNRRVRRNLFGPVDRDQLQVEYQAALRKDLDEASKRWGFDFKSYKPLE
SSDFKWEGIPETRVPLLYRSCVPAEGLGPAGGAVPTKPARVEKENIPQTPGKRKLQDLKK
TPAKGEKAALKRKQTNITDFYQAKRRVVWKPRKSGE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggctcctcacaagccgacgctgagctccctcggggggaacagacgggtccgcaggaac
ctgttcggcccggtggaccgagaccaactgcaggtggagtaccaggcagcgctgcgcaag
gacctggacgaagcgtccaaacgatggggctttgacttcaagtcgtacaagcctctggag
agcagcgacttcaagtgggagggcatcccagaaaccagggtgccactgctctaccggtcc
tgcgtgccggcggagggcctggggccggcaggaggggctgttccgaccaaaccagcaagg
gtggagaaggagaacatccctcagacgccagggaagaggaaactgcaggacctgaagaaa
acgccagcgaagggagaaaaagctgcgctgaagaggaaacagacgaatattacagatttc
tatcaggccaagagacgagttgtgtggaagccgaggaaatccggggagtga

DBGET integrated database retrieval system