KEGG   Xiphophorus maculatus (southern platyfish): 102223585Help
Entry
102223585         CDS       T02923                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00052  Galactose metabolism
xma00500  Starch and sucrose metabolism
xma01100  Metabolic pathways
xma04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102223585
   00500 Starch and sucrose metabolism
    102223585
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102223585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102223585
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102223585
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102223585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102223585
NCBI-ProteinID: XP_005812955
Ensembl: ENSXMAG00000011529
UniProt: M4AAT0
LinkDB All DBs
Position
5
AA seq 972 aa AA seqDB search
MVSYERLNPENVQFSGALLSEEHHRPAQEDVAVPQPDSTSLLPRRLSCSITKAVLILGSL
LLVLFGGWLLHTIYWLRTTSGQAHRPPPPAPGQALGPVLQADINDTATAARSKACSAIPE
AWRFDCYPEKAVVVTRELCQARSCCFIPASGSTRGRSRKNGIPWCFYPPDFPSYSLVSSK
ETSMGLKGTLVKDVKTYYPGDILTLEMEIRHETDTRLRVRITDPSSSRFEVPLSVPTATK
KAENPKYVVELSKQPFGLVVKRKSTGTVLLNTTVAPLFYADQFLQLSTALPSQFIYGLGE
HRSTFLHDVQWNTLTMWARDVPPTEQTNLYGVHPFYMAMEDGGDAHGFFLLNSNAMDVAL
QPGPALTWRSIGGILDFYVFLGSDPGSVVQQYVEVIGQPAMPIYWALGYHLCRWGYKTSN
ATWEVVKRMRNYGIPQDVQWNDIDYMDQAKDFTFDPTNFNTLPDLVRDLHAHNQTYVMIM
DPGISSTQPEGSYWPFDEGLKRGVFIKDAEGKTLIGKVWPGLTAFPDFSDEATHEWWYEN
LQRFHEKVPFDGLWIDMNEPSNFLDGSTVGCPSNSLENPPYTPGVLGGLLRSKTVCASAQ
QKLSTHYNLHSLYGLMEAKATSSALKRILAKRPFVISRSTFPSHGSYSGHWLGDNRSHWK
DLYTSIAGMLTFNLLGIPLVGADVCGFSEEPQEELCVRWTQLGAFYPFARNHNSLDMNPQ
DPTAFSPSARTAMKQALLLRYSFFPFLYTLFHHAHVKGHTVARPLMFEFPKDVKTYGIDS
QFLWGRSLLVTPVLEPGVDYVDGYFPEGLWYDYYTGDSVSSKGEELRLSAPLDKINLHLR
QGSIIPTQEPNVTLWISSGQPLHLVSALSDDGSASGDLFWDDGETIDTYETDRYTYVVFN
ISQNTMTSSVLHSDQEGSFLSIDSVSFYGVKQKPSAVLVNSQEFPFIYRDNQVLSVASLS
LRLTQNFTISWM
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttatgagaggctgaatccagaaaacgttcagttttctggtgcacttttatca
gaagagcatcaccgtccggctcaagaagatgtggccgtgcctcagccagacagcacctct
ctgctccccagaaggctgtcatgctcaatcaccaaagctgtgctgatactcggcagcctg
ctgctggtcctgttcgggggctggctgctgcacaccatttactggctgcgcaccacatcc
ggccaggcgcacaggccgccgccgccagcgccagggcaggctctgggccccgtcttacaa
gcagacataaacgacacggcgaccgctgcacgttccaaagcttgcagtgctatcccagag
gcgtggaggttcgattgctaccccgagaaagcggtggttgtgacccgggagttgtgccag
gccaggagctgctgcttcatccccgcttctggttcaactagaggcagatccaggaaaaat
ggtatcccctggtgtttctatccccctgacttcccctcatactctttggtgtcatcgaaa
gagacgtcgatgggactcaaaggcaccttggtaaaagatgtgaagacttactaccctgga
gacatcctcactctggagatggagataaggcacgaaacggacacgcgcctgcgtgtcagg
ataacagacccctccagttcacgcttcgaggtcccactctctgtccccactgccaccaag
aaagcagaaaaccccaagtacgttgtagagctttcaaagcagccctttggtctcgtggtg
aagaggaagtctacaggaaccgtgctcctgaacaccacagtggcgccgctcttctacgct
gatcagttcctccagctctccaccgccctgcccagtcagttcatttatggcctgggtgaa
caccgctccacctttctgcacgacgtccagtggaacacactcaccatgtgggccagagat
gttcctcccacggaacagacgaacctctacggggttcatccgttttatatggcgatggag
gacggtggggatgcacacggcttcttcctgctgaacagcaacgccatggatgtggccctc
cagccgggccccgccctgacctggcgtagcatcggaggaatcctggacttctacgtgttc
ctcggttcggatcctggttcagtcgttcagcagtacgtggaggtcataggacagccagcc
atgccaatctactgggccttagggtaccacctctgtcgctggggctacaagaccagcaat
gccacctgggaagttgtcaagagaatgaggaattatgggataccgcaggacgtgcagtgg
aatgacatcgactacatggaccaagctaaagacttcacctttgacccgacgaacttcaac
acccttccggacttggtgcgggacctgcacgctcacaaccagacctacgtcatgataatg
gacccaggaatcagcagcacacagccggagggctcctattggccgttcgacgagggactg
aagagaggagtcttcatcaaggacgctgaagggaagacgctaatcgggaaggtgtggcct
ggtctgacagcatttccggacttctccgatgaggcgacgcatgaatggtggtatgaaaac
ctgcagaggtttcatgagaaggtgccatttgatggattgtggattgacatgaacgagccg
tcaaacttcctggatggatctactgttggctgcccgtcaaacagtctggaaaatcctccg
tatacgccaggtgtgctgggaggtttgctcagatctaaaactgtatgcgcctctgcacag
cagaaactgtcaacacattataacctgcacagtctctatggactcatggaagctaaagcc
acctctagtgctctgaagaggattttagcaaagaggccgtttgtgatctcgcgctccacg
ttccccagtcatggctcgtattcaggtcactggctgggagacaacaggagccactggaag
gacctttacacctccatcgcaggtatgttgacctttaaccttctgggcatcccgttggtg
ggagcagatgtctgcggcttcagcgaggagccgcaggaggagctgtgtgtccgctggact
cagctgggagctttttatcccttcgcaagaaaccacaactcccttgacatgaatcctcag
gatccgaccgctttcagcccgtcggcccgtacggccatgaaacaggctctgctgctgcgt
tactccttcttcccgttcctctacaccctctttcatcacgctcacgttaaagggcacact
gtagctcggccgctcatgtttgagtttcccaaagacgtaaaaacgtacggcattgacagt
cagtttctctgggggaggagcttattggtgactccagtgttggagcctggagtggactat
gtggacgggtacttcccagaaggcctgtggtatgactattacaccggcgactctgtgagc
agcaaaggggaagaacttcgcctcagcgcaccattggataaaatcaacctgcatctgcgt
cagggctccattattccaacacaggagcccaacgtgacgctgtggatcagcagcggtcag
ccgctgcacctggtctctgctctgtctgacgacggctcggccagcggcgatctgttctgg
gacgacggcgaaaccatcgacacctacgagacggaccggtacacatacgttgtgttcaac
atctcccagaacacgatgacgtccagcgtgcttcacagcgaccaggaaggctcgttcctc
agcattgactcggtctcgttctacggggtgaagcagaagccgagcgcggtgctggtgaat
tcccaggagtttcccttcatctacagagacaaccaggtcttatcggtagcgagcctgagc
ctcagactcacccagaacttcaccatcagctggatgtaa

DBGET integrated database retrieval system