KEGG   Xiphophorus maculatus (southern platyfish): 102224137Help
Entry
102224137         CDS       T02923                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like isoform X2
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04210  Apoptosis
xma04625  C-type lectin receptor signaling pathway
xma04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102224137
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102224137
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102224137
   04672 Intestinal immune network for IgA production
    102224137
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102224137
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102224137
Protein kinases [BR:xma01001]
 Serine/threonine kinases: STE group
  Other
   102224137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 102224137
NCBI-ProteinID: XP_014330602
Ensembl: ENSXMAG00000009223
LinkDB All DBs
Position
16
AA seq 869 aa AA seqDB search
MAVRQRLFNSTAPFSGSPKTELKGSYPPSSCKEQEAEEEEDDGKDSKLSYMQETGWIPSP
QMKKVLTHGTAEQVGEMPIKTSTIIAQAECETQDSQEFSPSCSERYVPFPNCLTSLSSEH
NHVACPTSALFQKPHVTQAKSQRRQKSKGKRKKQGKGKEKQRRRHRTLSGVPEQESGLIQ
EEFSGGLSSFSTSRCSSVESLVEQECGNPFYNRQIYLTGSSCAPLNWPHPNFSLSSFPAD
EQDNSSDSFSSVGDCSLALAGLRYVVSQADPCYTRPFFKDVESEARENEDELSKADSECN
EGLIFNSDKIQPVDFEYKEGREYILSHFIKEGSYGEVHSAQDVNTGHRFAAKKIALKKFS
SEEVGAWSTLRSPRITELFGVVREGLNVVLLMEEKSGSLGQLIMKRGRLPEDLSLHYQSQ
VLAALEYLIKKKVAHLDIKADNVLLSEDGRDTFLCDFGHAEKLDNQGQSLSTSRDLKGTE
THMAPEIVKGEHRGAKADVWSSCCMLLHMLNGCQPWTRYYTCRLYLKIANEPPPIGEIPP
DCSPLTAEVLKAGLQKDPVKRSSASQLKEKTDRALKEVGGLTSSVQGPYTEPLYVPNKPP
DDLHPIYSSGEFEDEEEHKKSADKIITDLRTKNKAPEKDLETSLNEPKRESWNAPQMLVP
ELNFKRNNKITTVPELELRKLERDFYLSSLSQLPSAEMQEQLLSCINSDHYCNWELWDKK
DSGRWSLNPGDEYSSGFVSYNSQPDVQVFSLDLLGQTPPCCFEGVDVCIRDFSRKKIQIR
EKRRVKVGHIATGISDQISERVFTLETQNGQQISHEEEVLESGLELRCVSAPDFSSAWRW
RIKDGVLETSKNPHFCSTTEMQLIHSVLT
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaggcagaggcttttcaattcaaccgctccattctctggttcccccaaaacc
gagctgaaggggtcctatccgcccagctcctgcaaagagcaggaggcggaagaggaggaa
gatgatgggaaggacagcaaactgagctacatgcaagaaacaggatggattccaagtcca
cagatgaaaaaagtcctgacgcatggaactgctgagcaagtgggagaaatgccaatcaag
acctctaccatcattgctcaagctgaatgtgaaactcaggattcccaggaattcagtccc
tcttgttctgaaagatatgtccccttcccaaattgtttgaccagcctttcctcagagcac
aaccatgtagcatgcccaacttcagccttattccaaaagccacatgtcacacaggcaaag
agtcaaagaaggcaaaagagcaaaggaaagagaaaaaagcaggggaaggggaaggagaag
cagcgacggagacatcgaacgctctccggagtccctgaacaagagagtggcctgatccag
gaggaattctctggaggactaagcagctttagcacatctcgctgtagcagcgttgaaagc
cttgtggagcaagagtgtggcaatcctttctacaacagacagatctacctgactggctca
agctgcgctcctctgaactggcctcacccaaactttagcctctccagcttcccggcagat
gagcaggacaacagctcagactccttcagcagtgtgggagactgctctctcgcccttgcg
ggtctcagatatgtagtcagccaggcagacccttgctacacgcggccgtttttcaaagat
gtggagagcgaagctagggagaatgaagatgagctttcaaaggctgattcagagtgcaat
gaaggactcatcttcaacagtgataaaatccaacctgtggactttgaatataaggagggg
agggagtacatcctctcacattttatcaaagaaggttcctatggtgaggttcacagtgct
caggatgtcaacacaggacacagatttgcagccaaaaagattgccctgaagaaattcagc
agtgaggaggtgggtgcgtggagtaccctccgatctcctcgtatcactgagctctttgga
gtagtcagagagggactaaatgttgtccttttaatggaggaaaaatcaggctccctgggt
cagctgataatgaagcgtggccgactgccagaggatttaagtcttcactaccagtctcag
gttttagcagccctggaatacctaataaagaagaaagtggcacatttggatattaaagct
gacaatgtgttgctgtcagaagatgggagagacactttcctgtgtgactttggacatgca
gagaaactcgacaaccagggccagagcctcagtacttccagagatctgaagggaacagag
acccacatggcccctgagattgtaaaaggagaacaccgtggagccaaagcagatgtgtgg
agcagctgctgcatgttgcttcacatgctgaacgggtgtcagccatggacaagatactac
acctgcagactctacctgaagattgcaaatgagcctccgccaatcggagagatcccacct
gactgcagccctctcacggctgaagttttaaaggctggactccagaaggatccagtcaag
agatcatcagcatctcagctcaaagaaaaaaccgatagagctctgaaagaagttggagga
ttaaccagttcagtccagggaccctacacagagcctctatatgttccaaacaaaccacct
gatgaccttcaccccatttatagcagtggtgagtttgaggatgaggaggaacacaagaag
tctgcagataaaataataacagacctaagaacaaaaaacaaagctcctgagaaagacttg
gagaccagcctcaatgagccaaaacgggagtcgtggaacgctccacagatgctcgtccct
gagctaaacttcaagagaaacaacaagatcaccactgtgcctgaacttgagcttcgcaaa
ctggagcgagacttctacctgagcagtctgtcgcagcttccttctgctgagatgcaggag
cagctcctgtcttgtattaacagtgaccattattgcaactgggaactatgggacaaaaag
gactctggtcgctggtccctgaaccccggagatgaatacagctccggtttcgtctcctac
aacagccaaccagatgtacaggtctttagtttagatttgcttggtcaaacaccaccttgt
tgttttgaaggggtggatgtctgcatcagagacttcagccggaaaaaaattcagatcaga
gagaaacgtcgggtgaaggttggccacatcgctactggcatcagtgatcagatttcagag
cgggtattcaccctggagacccagaacggccagcagatcagtcacgaggaggaggtgctg
gagtctggtcttgaactccgctgtgtttctgctccagacttcagctccgcttggaggtgg
aggatcaaggacggagtgttggagacgagcaagaatccgcatttctgttctaccactgaa
atgcagctgattcactctgtcttgacctga

DBGET integrated database retrieval system