KEGG   Xiphophorus maculatus (southern platyfish): 102224825
Entry
102224825         CDS       T02923                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X2
  KO
K05437  erythropoietin
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102224825 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xma04052]
    102224825 (epo)
Cytokines and growth factors [BR:xma04052]
 Cytokines
  CSF and other factors
   102224825 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102224825
NCBI-ProteinID: XP_014324781
Ensembl: ENSXMAG00000013608
LinkDB
Position
14
AA seq 185 aa
MLRKTCRGLFALLLLVLEWTRPGLPSPLRPICDLRVLNHFIQEARDAEVTMKSCREGCGL
TEAVSVPQTTVNFDDWEKKNAMEQAQEVQTGLWLLQQALSLLRTSMTNSELNSHIDNVIR
NLHSITAVLRSLNFQEYTPPASTVGPEGTWRVSTATELLQVHLNFLRGKVRLLLLDAQAC
QQEAS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcggaaaacttgtagaggactgttcgccttgctgctattagtgttggagtggacc
cgtccaggcctaccgtccccactaaggccaatctgtgacctcagggtcctgaaccatttc
attcaggaagcacgagacgcagaagtcactatgaaatcatgcagagaaggatgtggtctg
acagaggctgtctctgttccccaaactacggtcaactttgatgactgggaaaagaaaaat
gcaatggagcaagctcaggaagtgcagaccggattgtggcttttacaacaggccctcagc
ttactacggacatcgatgacgaactcagaacttaatagccacatagacaacgtcatcaga
aacctacacagcatcaccgctgtactacgaagcctcaactttcaagaatataccccacct
gctagtactgtgggaccggagggaacatggcgggtgtccacagctacagaactgcttcaa
gttcacctcaatttcctgcgaggcaaagtacgccttcttcttttggacgcacaggcttgt
cagcaagaagccagctga

DBGET integrated database retrieval system