KEGG   Xiphophorus maculatus (southern platyfish): 102225304Help
Entry
102225304         CDS       T02923                                 

Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00052  Galactose metabolism
xma00500  Starch and sucrose metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102225304
   00500 Starch and sucrose metabolism
    102225304
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102225304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102225304
NCBI-ProteinID: XP_023208375
Ensembl: ENSXMAG00000009299
LinkDB All DBs
Position
19
AA seq 898 aa AA seqDB search
MAAKSEPIISVVPNDEGKEKFKNSENAAFYRRQIQGPNLEYRLLLDSLVLAEKGARLELL
EDGTKTRLLLSLTPCKSDTVRIVIDEIRPIKTRYRVPDVLTGEPPSEQLRVESKTKDSVT
LSWSSGRHQVRMWHFPFRLEVLCDQEVIVTFNSKDKLWFESLQNKPSKLEDDKNSLWRET
FRNFEDIKANGPSSLGADFCLHGFQHVYGLPQHADRLRLRDTSDGEPYRLYNLDVFAADL
YCRLGLYGSVPLIVAHKPDRTVGVFWLNASDTFINIQYSPSDPRDGETPPVKRRRLRPQT
DAQTDVHWLSESGVIDCTILLGPAPQQLFRQYAELTGYQAMPPLFSLGYHQCRWNYNDEA
DVKAVDAGFDRHEIPYDVIWLDIEHTDGKRYFTWDPALFPKPAALQQHLEKKKRKMVVIS
DPHIKVDPDWPLYREARDGGHFVKDREGQIFRGTCWPGESSYLDFSCPETRAWYSRCHSF
DKYKGSTASLFVWNDMNEPSVFNGPEQTMPKDAVHHGGWEHRELHNLYGFYQHMATADGL
MSRSGGSERPFVLTRSFFAGSQRLGAIWTGDNVATWEYLKISLPMVLTLSLTGIAFCGAD
VGGFVKDPDPELLVRWYQAGALQPFFRGHSANDTKRREPWLFGEEVTAAIRTAIQQRYCL
LPFWYTLFHFAHTAGLPPVRPLWVEFPREESTFTEDNQYMIGGALLACPVTEPGAQTVKV
LLPGYDEIWYDISSAKTYKGGKSLSLPVNLDTVPVFQRGGSVVCRSTGSGTCTADYQKLP
LDVTVALNSQASADGELYLDDGHSFQYRDKKAFSLRRFSMASGRLLCRSASEEGRFDCDT
VVQSVSIMGVKSKPTTANVHVPGAKSVSASFEFLEACCKLKLNNLNVRVTMDWDIQIN
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaagagcgaacctattattagtgttgtccctaatgatgaggggaaggagaaa
ttcaaaaatagtgagaatgctgctttttacaggcgacagatccagggtccaaacctggaa
taccgacttcttttggattcccttgtcctcgcggagaagggcgcacgtcttgagcttttg
gaagacggcacaaagaccagactgcttctttctttgacaccttgcaaaagcgacaccgta
cggatcgtaatagacgagatccggcccattaaaacccgttacagagttccagatgtgttg
actggggaacctcctagtgaacagttgagagtggagagcaagactaaggactccgtcacc
ctctcctggtcttcggggcgacaccaggtccgaatgtggcacttccctttccggctggag
gttctgtgtgatcaggaagtgatcgtcaccttcaactccaaggacaaactgtggtttgaa
agcttgcagaataaacccagtaagcttgaagacgacaagaattcactgtggagggaaact
tttaggaactttgaggacatcaaagcaaacggtcccagcagcctcggcgccgacttctgc
cttcacgggttccagcacgtctacggtctgccgcagcacgcagacaggctgcggctcaga
gacaccagcgatggcgaaccttaccggttatacaacctggacgtgttcgccgccgacttg
tactgccggctcggtttgtacggatccgtgccactgatagtggctcacaaaccagacagg
accgttggcgtgttctggctgaacgcgtcggacacatttataaacatccagtactcccct
tctgaccctcgggacggcgaaacacctccggtgaagaggaggcggctgcggcctcagacc
gacgcccagaccgacgtccactggctctcggagagcggggtgattgactgcacgattctg
ctcgggcccgcgccgcagcagctcttcaggcagtacgctgagctcacaggataccaagcc
atgccgccgctgttttccctcggttaccaccagtgccgctggaactacaacgacgaggcc
gacgtgaaggccgtggacgccgggttcgatcgccacgagatcccgtacgacgtcatctgg
ctggacatcgagcacacggacgggaagcgctatttcacctgggaccccgctctgtttccc
aaaccggcggctctgcagcagcatctggagaagaagaagcggaagatggttgtgataagt
gatccgcatattaaggtcgaccctgattggccgctctaccgtgaggccagagatggaggg
cattttgttaaggacagagaggggcagatctttcggggcacatgctggccaggcgagtca
tcgtatcttgacttcagttgtcctgaaacccgagcgtggtactccaggtgccacagcttc
gataaatacaagggatcgacggcgtcgctgtttgtgtggaacgacatgaacgagccgtcc
gtcttcaacgggccagagcagacgatgccgaaggacgcggtgcaccacggaggctgggag
catcgggagctgcacaacctgtacggcttctaccagcacatggccacggcggacggtctg
atgtcccgctcaggaggctcggagaggccgtttgttctcacacgctccttctttgctggg
tcacagaggctgggcgcaatatggacgggagacaacgtagccacctgggagtatctgaag
atttcactgccaatggttttgaccctgagcctgacaggcattgcattttgtggagctgat
gtcggtgggtttgttaaggatccagatccagagttgttggtgcgctggtaccaggccgga
gctctgcagccattcttccgcggccactccgcaaacgacacaaagcggcgggagccttgg
ctttttggggaagaggtcaccgcggcgatacgcaccgccatccaacaacggtactgcttg
ttgccgttctggtatactctcttccacttcgctcacaccgctggtctgcctccagtcaga
cctctttgggtggagttcccaagagaggagagcacgttcaccgaggacaaccagtacatg
attgggggagccctgctcgcctgtcctgtgacggaaccaggcgctcagacagtcaaagtc
ttacttcctggctacgacgagatttggtacgacatcagctctgcaaagacgtacaaagga
ggaaagagtttgagtcttcctgtcaacttggacactgttccagtgtttcagcggggcggc
tcggtggtctgcaggtcaacgggaagcggcacgtgtacggccgactaccagaagctgcct
ctagatgtcactgtggccctaaactcccaggccagtgcagacggagaattgtacctcgac
gacggccactccttccagtaccgggacaaaaaggccttctccctgcggcggttcagcatg
gcgtcaggccgtctgctctgccgttcggccagtgaagaggggaggtttgactgtgacacc
gtcgttcagtctgtttccatcatgggagtgaagagcaagccgaccacggcgaatgtccac
gtcccaggtgctaaatccgtctctgcttcctttgagttcctggaagcctgctgcaagctc
aaactgaacaacctgaacgtcagagtgacgatggactgggacatacagatcaactga

DBGET integrated database retrieval system