KEGG   Xiphophorus maculatus (southern platyfish): 102225633
Entry
102225633         CDS       T02923                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04141  Protein processing in endoplasmic reticulum
xma04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102225633 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102225633 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102225633 (atf6b)
Transcription factors [BR:xma03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102225633 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU CENP-H PBP_sp32 DUF4140 SlyX
Other DBs
NCBI-GeneID: 102225633
NCBI-ProteinID: XP_005804780
Ensembl: ENSXMAG00000001548
LinkDB
Position
13
AA seq 715 aa
MTADLLSDLDSRFFADNLLTSEDWDACLFKCESMEEGEDGDFSQGLKYEPSFDNDLVLTL
DPDNRTSPWRYLDDNLLTGSTSVIKNEMTLTEPLPVEMLFQVKAEPPSPASSLDSDCSTL
SPDPQVTIKAENPPTPPYMYGDVLSPPLGTMEVTVATTAVPPPQSQIPIMTQTQLQTPLT
SVQAVINGIPTQTAVLPSTLKASTILSTKPPIQPRPVCVAATLPVPQNPAPAKTLILQGL
PSMDQNRPVVLSPSVCLSSAPAIVKMEPVSPTIPQHCSSPAASSTSKPIVPATTPLPSNN
SNDIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRER
LAVKESGDSASNKRAVCVMAVLLFMTFSFGPVSITDRKLSASLQEDLVSYTGRRLLEIEQ
QPDRQADPQPLQKIEDKPEKPESGGDERWKGGEAERYAPESYQFRNLSDMFSDLKDLVLP
DIERYFTSSDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKAKTAKKAKITQKAQLRK
ANISRYLPIQAHRSIESQLRVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISH
NKTSRPKMSLVMPAMSVNESLYNSSQGYEMMMQVDCEVMDTRIIPIKSSAVPPSLREPSP
PPPSSQHGAHHHHGNSTSLRGRHQHHPSSSSPSPRQPLPARTQTPEYLISQSEGV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgactgcggatttactgtctgatctggacagccgattcttcgctgataaccttttgacg
agcgaagattgggatgcctgcctgttcaagtgtgagagcatggaggaaggagaggacggg
gacttcagtcaagggttgaaatacgaaccatcgtttgacaatgacctcgtgctcaccctc
gatcctgataaccgcacgtcaccatggcgataccttgacgacaaccttctcacaggaagc
acttcggtgataaaaaatgagatgacattgacagagccgctccctgtggaaatgttgttc
caggtcaaggctgagcctccctctcctgcttcctcgctggactcagattgttcgaccttg
tcgcctgacccacaggttacaattaaagccgaaaaccctccgactcctccgtacatgtat
ggagacgtactgtctcctccgctggggacgatggaggtaaccgtggcaactacagcagta
cccccaccccagtcccagattccaataatgacacagactcagctgcagacaccattaaca
tctgtccaagcagtcatcaatggaataccgacacaaactgcagtcctgccaagcacatta
aaagccagcaccatcctgagcaccaaacctcccatccagccccgaccagtgtgtgttgct
gctacactccccgtcccgcaaaaccctgcaccagcgaagaccctcatactgcaggggctc
ccctccatggatcagaacagacccgttgtcctctctccgtccgtctgtctcagttcggct
ccggctattgtcaaaatggagcccgtgtcccctaccatccctcagcactgctccagccca
gctgcctcctcaaccagcaagcccatcgtcccggcgaccacgccgttacccagcaacaac
tccaacgacattgatatgaaggtgctaaagcggcaacagaggatgataaaaaacagagag
tctgcctgccagtcgagaaagaaaaagaaggaatacctgcagaacctggaggctcagctt
agggaagctcagcaggagaacgaacgactccgcagggagaaccaggcgctgagggagaga
ctggctgtgaaggagagtggcgactctgcaagcaacaagagagcagtgtgtgtcatggcg
gttctgctgttcatgactttcagctttggccccgtcagcatcactgacaggaagctgtca
gctagtctgcaggaagatctggtgtcttatacgggtcgccggctgctggagatcgaacag
cagccggatcgccaggctgatcctcaacctctccagaaaattgaggacaaaccggagaaa
ccagagtccggcggcgatgagcggtggaagggaggagaggcggagagatacgctccagag
tcttatcagttccgaaacctgagtgacatgttcagtgacttgaaggatctggttctgcca
gacatcgaacgttacttcacttcctcagactgccgacagttcaaccgctctgagtctctc
aggctcgcagacgagctaagaggatgggttcatcgacatcaaatcgacaggaagaagtct
ggaggaaaagcaaagacggccaaaaaagcaaagatcacccagaaagctcaactgaggaag
gcaaacatttccagatatctgccaatccaggctcaccgctccatagaaagtcagctgagg
gtacttcctggacctgaggtcacctacagcgacttcctggacgccatcgaccgtagggaa
gacacgttctacgtcgtgtctttcaggagggaccacctgttactgcctgccatcagccat
aacaaaaccagccggcctaaaatgtctctggtgatgccggccatgtctgttaacgagagt
ctctacaactcgtctcagggctacgagatgatgatgcaggtcgactgcgaggtcatggac
actcgcatcatccccataaagtcctctgccgtccctccatctcttcgtgaaccctcccct
ccaccaccctcctcccagcatggtgcccaccatcaccatggcaacagcacctccctcaga
gggcgccaccagcaccatccatcgtcttcatccccttctccaaggcagcctctacctgcc
cgaactcaaacacccgaatacttgatcagccaatcagaaggggtctga

DBGET integrated database retrieval system