KEGG   Xiphophorus maculatus (southern platyfish): 102225805
Entry
102225805         CDS       T02923                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00480  Glutathione metabolism
xma00980  Metabolism of xenobiotics by cytochrome P450
xma00982  Drug metabolism - cytochrome P450
xma00983  Drug metabolism - other enzymes
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102225805
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102225805
   00982 Drug metabolism - cytochrome P450
    102225805
   00983 Drug metabolism - other enzymes
    102225805
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xma02000]
    102225805
Enzymes [BR:xma01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102225805
Transporters [BR:xma02000]
 Other transporters
  Pores ion channels [TC:1]
   102225805
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin MazG-like SKIP_SNW GST_C_6 GST_C_5
Other DBs
NCBI-GeneID: 102225805
NCBI-ProteinID: XP_014326423
Ensembl: ENSXMAG00000012943
LinkDB
Position
22
AA seq 239 aa
MATEKCFAKGSPVPGPVPKGQLRLYSMRFCPFAQRTRLALNAKGIKYDTININLKEKPEW
FLEKNPLGLVPALETSAGEVIYESSITCEYLDEAYPEKKLLPSSPFGKAQQRMLLEHFSK
VIPYFYKIPLARRTGVDVSTQEVELKEKFAKLNEHLEKKKTKFFEGDTITMIDYMMWPFF
ERIEVLELKHCLDHTPELKKWTEHMLEDPAVKATMFNMDTHKAFYKSVAEGKPDYDLGL
NT seq 720 nt   +upstreamnt  +downstreamnt
atggctactgaaaaatgtttcgccaaaggaagccctgtacctggccctgttcccaaaggt
caactgcgtctctacagcatgagattctgcccttttgctcaaaggaccagattagcgctg
aatgccaaagggatcaaatatgacaccatcaacatcaatttgaaagagaaacctgagtgg
tttcttgaaaagaaccctctcggtcttgtgcctgcactggagacatctgctggtgaagtt
atatacgagtcctccatcacctgtgagtatctggatgaagcgtatcctgagaaaaagctt
cttccatcctctccttttggaaaagcccaacaaagaatgctactggagcatttttccaag
gtaataccttacttctacaagatccctttagcaaggaggactggagtggatgtctctaca
caggaagttgagctgaaagagaaatttgctaaattgaatgagcacttggagaagaaaaag
acaaagttctttgaaggtgacaccatcacaatgatcgactacatgatgtggccatttttt
gagaggattgaggtcttggagctgaagcactgcctggaccacactcctgagctgaagaag
tggactgagcacatgctggaggatccagctgttaaagccaccatgttcaacatggacacc
cacaaagccttctacaagagcgttgctgaggggaaacccgactatgacctcggcctgtaa

DBGET integrated database retrieval system