KEGG   Xiphophorus maculatus (southern platyfish): 102225937Help
Entry
102225937         CDS       T02923                                 

Gene name
eif3a
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03013  RNA transport
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102225937 (eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:xma03012]
    102225937 (eif3a)
Translation factors [BR:xma03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    102225937 (eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 102225937
NCBI-ProteinID: XP_005795248
Ensembl: ENSXMAG00000007944
UniProt: M4A0J0
LinkDB All DBs
Position
22
AA seq 1252 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVIKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTETAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSKVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFALSKKPPKPQLMANYYNKVSTVFWKSGNALFHACTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKHRRLATLLG
LQSPPTRQSLINDMVRFNLLQYIVPEVKELYNWLEVDFHPLKLSGRVTKVLNWVRDQAEK
EADLQQYVPHLQSNTILRLLQQVAQIYQSIEFSRLASLVPFVDAFQLERSIVDAARHCDL
QVRIDHTSRTLSFGSDLNYSTKEDSPVGPFLQNMPSEQIRNQLTAMSASLAKAIQVIKPA
SNLQERDEHNQQAIAAYLKNARKDHQRILARRQTIEERKERLESLNIQREKEELEQREAE
MQKVRKAEEERLRQEAKEREKERIMQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKKAYEEQRVK
DMELWELQEEDRINNLKIEREKALEHKKRMSRMMEDKEGFLAKITAARSFIYEEKLKTFE
ERLVEERKTRMEERKRQRKEDRRNTFYRQKEEEAQRIHEEQLKKEREERERLEQERREEE
EREYQERLRKLEEQERKQRARQQEIEERIRQKTVSPQEKKPKEEKDEGGWRRKTDGDSEW
RRPVPDKDWRQEGREDNREERDGPFRRGDGPRRDGDDRGPRRGFDDDRGPRRGGDDERPP
RREMDDDRGPRRGFDDDRGPRRGGDEDRGPRRGFDDDRGPRRGFDDDRGPRRGFDDDRGP
RRGFDDDRGPRRGLDDSRGSRRGADDDWGPRRDMDDGPRRGEDAKPWKPLGRPGGWRERE
KAREESWGPPRGGANDDGEEDDGDERTSDRFRDRRPQREENPWRRGGNEEGSWRDSRREE
TDKDERRSDRDDRRSDRDDRRSDRDDCRSDRRDRDRRDDREHRPPPRDTDEGSSWRRGGD
NKREERERERPREREREQECDADGEKAWRTDKENARRTKNETDDDGWTTVRR
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgtatttccagcggccagaaaacgctctcaagcgagcgaacgaatttcttgag
gtcggcaagaagcagccagccttggatgttttgtacgatgttatcaagagtaaaaaacat
cgaacatggcagaagatccacgagcccatcatgctcaagtacctggagctgtgtgtggat
ctgcgcaagagccacctggccaaagagggtctctaccagtacaagaacatctgccagcag
gtgaacatcaaatctttggaggatgtggtcagggcttacctgaagctggcagaggaaaag
acggagacagccaaggaggagtcacagcagatggttctggacatcgaggacctggacaac
atccagactccagaaagcgtgctgctgagcgctgtgagcggggaggacacccaggatcgt
accgaccgcctgctgctcacgccgtgggtgaagttcctgtgggagtcgtaccgccagtgc
ctggacctgctgagaaacaactccaaggtggagcgtctgtatcacgacatcgcccagcaa
gctttcaagttctgcctgcagtacacccgaaaagcagagtttcgcaagctgtgcgacaac
ctgcgcatgcatctgggtcagatccagcggcaccacaaccagagtaccgccattaacctg
aacaaccctgagagccagtccatgcacctggagacgcggctggtgcagctggacagcgcc
atcagcatggagctctggcaggaagcgtttaaggccgtcgaggacatccacggcctcttc
gccctctccaagaagcctcccaagccacagctcatggccaactactacaacaaggtttcc
acggtcttctggaagtctgggaacgctctcttccacgcctgcactctccaccgcctctac
catctgtcgagggagatgcgcaagaatctgacccaggacgagatgcagaggatgtccacc
agagtcctcctggccactctgtctattcccattacccctgaacgcaccgacatcgctcgg
cttctggacatggacggcatcatcgtggagaagcaccgccggctggccaccctgctgggc
ctccagtccccaccgacccgccagagcctcatcaacgacatggtgagatttaacctgctg
cagtacatcgtccctgaagtgaaggagctctacaactggctggaggtcgactttcatccg
ctcaagctgagtgggagagtgacgaaggtgttgaattgggtgagagatcaggctgagaag
gaggcagacctgcagcagtatgtccctcacctgcagagcaacaccatccttagactcctg
cagcaggtggctcagatctaccagagcatcgagttcagccgtctggcctccctggttccc
ttcgtggacgccttccagctggagcgctcaatcgtggacgctgctcgccactgcgatctc
caggtccggatcgaccacacgtctcgaacgctgagcttcggctccgacctgaactactca
accaaagaggattctccggtcggtccgttcctgcagaacatgccgtcggagcagatcagg
aaccagctgaccgccatgtctgcttccctggctaaagccatccaggtcatcaaacctgcc
tctaacctgcaagagcgcgatgaacataaccagcaggccatcgctgcgtatctgaaaaac
gctcgcaaggaccaccagcgcatcctggcccgcaggcagaccatcgaggagcgcaaggag
cgcctggagagcctgaacatccagcgggagaaggaggagctggagcaacgagaagccgag
atgcagaaggtccgcaaagccgaggaggagcgtctgcggcaggaggccaaggagcgggag
aaggagcgcatcatgcaagaacacgaacaaatcaagaagaagacggtccgcgagcgactg
gagcagatcaagaaaacagagctgggagccaaagctttcaaggatattgacattgaggac
ctggaggagctggatcctgacttcatcatggccaaacaggtggagcagctggagaaggag
aagaaggaacttcaggagcgtctgaagaatcaagagaagaagattgattactttgagagg
gcaaaacgcctcgaggagattcctctgatcaagaaggcgtatgaggaacagcgagtcaaa
gacatggagctgtgggagctccaagaggaggacaggatcaacaacctgaagatcgagcgg
gaaaaagctctggagcataagaagcggatgtccaggatgatggaggacaaggaaggcttc
ctggccaagatcacggcggcccgcagcttcatctacgaggaaaaacttaaaacgtttgag
gagcgtttggtggaggagaggaaaacgcgcatggaagaaaggaagaggcagcgcaaagag
gaccgacgtaacacgttctaccgccagaaggaggaggaggctcagcggatccacgaggag
cagctcaagaaagagcgtgaggagcgagagcgcctggagcaggagcgccgtgaggaggag
gagcgggagtaccaggagcgtctgcgcaaactggaggagcaggagcgcaaacagcgcgcg
cgacagcaggagatagaggagcgcatccggcagaagaccgtcagcccacaggagaagaaa
cccaaggaggagaaggacgagggagggtggagaaggaaaactgacggcgactcggaatgg
cgccgcccggttcctgacaaggactggagacaggagggccgagaagacaaccgagaggag
cgggacggccccttcaggcgtggggacggtcctcgccgtgacggggatgaccgcgggcct
cgccgaggctttgacgacgaccgaggtccgcgtcgcggaggagacgatgagcgtccgcct
cgcagggagatggatgacgaccgtgggccgcgccgaggcttcgacgacgacagaggtccc
aggaggggcggggacgaagaccgcggacccagacgaggatttgacgacgaccgtggaccc
agacgcggtttcgatgacgaccgtggacccagacgcggcttcgacgacgaccgtggaccc
agacgtggctttgatgatgacaggggtcctcgcagggggcttgatgactccaggggttcc
agacgtggggctgacgacgactggggccccagaagagacatggatgatggcccgcgccgc
ggtgaggacgccaagccatggaaacccctcggcagacctggtggctggcgtgagcgggaa
aaagcccgagaggagagctgggggccgccccgcggcggcgccaatgacgacggagaagaa
gacgatggagacgagcgaaccagcgaccgcttcagagaccgtcgtccacagagagaagag
aatccctggaggagaggaggcaacgaggaaggaagctggagggattcccgcagagaagag
accgacaaggacgaacgccgtagcgaccgggatgaccgccgtagcgaccgggatgaccgc
cgtagcgaccgggacgactgccgtagcgaccggcgagacagagacagacgagacgatcgc
gaacacagacctccacctagagatactgatgaaggaagctcctggcgccgcggcggcgac
aacaaacgggaggagcgtgagagggaacgccccagagagcgagagagggagcaagagtgc
gacgctgacggggaaaaggcttggcgtaccgacaaggaaaacgctcgccgcaccaagaac
gagacggacgacgacggctggaccaccgtccggcgctga

DBGET integrated database retrieval system