KEGG   Xiphophorus maculatus (southern platyfish): 102226045
Entry
102226045         CDS       T02923                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04068  FoxO signaling pathway
xma04217  Necroptosis
xma04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102226045 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102226045 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102226045 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xma03000]
    102226045 (stat3)
Transcription factors [BR:xma03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102226045 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 102226045
NCBI-ProteinID: XP_005796755
Ensembl: ENSXMAG00000008972
UniProt: M4A3I3
LinkDB
Position
16
AA seq 787 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQTAT
STTQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDIGGKTQIQSVEPYTKQQLSSMSFADIIMSYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAHEPEPAGDSTSTIQPYLKTKFICVTPC
PSVFMDLQDSELLGNGFPGTNSGNTSDLFLMSPHTLDSLDSLMPGEAEANQGHLDSITLN
MDVASPM
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggcccaatggaaccagttacagcagctggagaccaggtatctggagcaactctaccac
ctttacagcgacagcttcccaatggagctgcggcaattcctggccccatggattgagagt
caggactgggcttacgctgccaacaaggaatcccatgccacgctggtgttccacaacctg
ctaggagaaatagaccagcagtacagccgcttcctgcaggagaataacgtactctaccag
cataacctgcgcaggattaagcaacatctgcaaagtaaatatctggagaagccgatggaa
attgcccggattgttgcccgctgtttgtgggaggaacaaagactgttgcagactgccacc
tcaactacgcaggatggccaagcagcccatcccactggaacagtagtgacagagaagcag
caaatcctggagcacaatcttcaagacatcagaaagcgtgtgcaggacatggaacagaag
atgaagatgcttgaaaacctgcaagatgattttgactttaactacaaaaccttgaaaagc
caaggagagttgtcccaggacctcaatggaaatagccaggcagctgccacaaggcaaaag
atggctcagcttgagcaaatgcttagcgcccttgaccagctcaggaggcaaatcgtgaca
gagatgggaggccttttgacagccatggattatgtgcagaagaatctgactgatgaggaa
ctggcagactggaagagaagacagcaaattgcctgcattggaggcccacccaacatttgc
ctcgatcgccttgagacatggatcacatccttggctgagtcccagctccagatccgtcag
cagattaagaaactcgaggaacttcagcagaaagtgtcctacaaaggagaccccatcatt
cagcatcggccagcgttggaggagaagattgtggatctgttcagaaacctcatgaagagt
gcctttgtggttgaaagacagccttgtatgcccatgcatccagacagacccctggtcatc
aaaacaggagtgcagttcacaacaaaagtcaggttgcttgtaaagtttcctgaactcaat
taccagctcaagattaaagtttgcattgacaaagaatctggggatgttgctgcaattaga
ggatctcgaaagtttaacatcctcggtaccaacacaaaagtcatgaacatggaggaatcc
aacaatggcagcctttcagcagagtttaaacacttgaccctacgagaacagaggtgtggc
aacggtggccggaccaacagcgatgcatccctcattgtaacagaggaactccatcttatc
acttttgagacagaagtctatcaccagggcctaaagatagatctggagactcattctctg
ccagtggttgtcatttcaaacatctgccagatgcccaacgcctgggcttccatcctgtgg
tacaacatgctcactaatcacccaaagaacgtgaacttcttcaccaagcctccggtggga
acctgggaccaggtggctgaggtgttgagctggcagttctcttcgaccactaagagaggc
ctgaccatcgagcagctgaccacgctggctgagaaattacttgggccttgtgtaaactat
tctggatgccaaataacatgggccaagttctgcaaggaaaacatggctggcaagggcttc
tccttttgggtgtggctggacaatatcattgacctggtgaagaagtacatcctcgctctg
tggaacgaaggatacatcatgggttttatcagcaaggagcgggagagagccattctgagt
ccgaagcctcctggcacatttcttctgcgcttcagcgagagcagcaaagagggcggcatt
acatttacatgggtagagaaagacattggaggaaagacccagatccagtccgtagagcct
tacaccaagcagcagctcagcagcatgtcgtttgcagatatcatcatgagttacaaaatc
atggatgccaccaatatcctggtgtcgccacttgtttatctctatcctgatatccccaaa
gaggaggcttttgggaaatactgcaggccagaggcagctcatgagcccgagccagcagga
gactcgacaagcactatccagccttatttgaaaacaaagttcatctgtgtgaccccgtgc
ccctccgtgttcatggacttgcaagacagtgagctgcttgggaacggattcccaggcaca
aactctggaaacaccagtgacctgttcctcatgtcgcctcacactctcgactccctggac
tccctgatgcccggcgaagctgaagcgaaccaagggcatttggattcaattactctgaac
atggatgtagcatctcctatgtga

DBGET integrated database retrieval system