KEGG   Xiphophorus maculatus (southern platyfish): 102226324
Entry
102226324         CDS       T02923                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
xma  Xiphophorus maculatus (southern platyfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1
Other DBs
NCBI-GeneID: 102226324
NCBI-ProteinID: XP_014327332
Ensembl: ENSXMAG00000017204
UniProt: M4AS04
LinkDB
Position
20
AA seq 358 aa
MTNCELIELKDLSVNDSIELAAPSSHIACAPVNPSQPGAGRVVRLVGDSVSIEGPVRHLG
EGAVGHDFQPYSYTHLSWCDLCGEFIWGLYKQILRCANCSYTCHYRCRPFIQLDCSTQGS
VLTENTDYSEDSIETDTNVDDQTEPGKQELSVGKIQQKVKEYNAQINNNLYMVDNKDGTY
TGFIKVHFQLLRPISLPPSRNQSWTEEDDQQERLTRRRTSFYLPKDAAKHLHVSSETRVR
EVIEALLNKFTVVDNPAKFALFERAEKQSQVFMRKLSDDERPLYLRLCAGPSESVLSLVL
KENETGDVNWDAFSFPELNNFLRILQREEEEHVRQIVNRYAHARDMIRHAMARVTTPG
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgactaactgtgagctgattgagctgaaggacctcagtgtgaacgattccatcgagcta
gccgctccatcctcacacatcgcctgtgcccctgtcaatccaagtcagcctggcgctggc
cgcgttgtccgtctggttggagacagcgtcagcatcgagggaccggtccgtcacttggga
gagggggcagtgggccatgacttccagccctatagctacacacacctcagctggtgtgac
ctgtgtggagaattcatctggggtctctataagcagatcttacgctgtgccaactgcagc
tacacttgtcactaccgctgccgaccgtttatccagctggactgcagcacacaggggagt
gtgttaacggagaacacagactacagtgaggactccatcgagacggacacaaacgtggat
gaccagactgaaccgggtaaacaagagttaagtgttggtaagattcagcagaaggtgaag
gagtacaacgctcagatcaacaacaatctctacatggtggataataaagatgggacgtac
actggtttcataaaggtccactttcagttactccgccccatctccctcccaccttctcgg
aaccagagctggacagaggaggacgatcagcaagaaagactgacaaggcggcggacgtct
ttctacctccccaaagatgcagcaaagcaccttcatgtgagctcagaaactcgagtgcga
gaagtcatcgaggcgttgctgaacaagttcactgtggtcgacaatccggcaaagtttgcc
ttgtttgaacgtgctgaaaagcaaagtcaagtgttcatgcgtaagctgtctgatgacgag
cgccctctgtatttgcgtttatgtgctggacccagtgaatcagtcttgagtctggttttg
aaggagaatgaaacaggggatgtaaattgggatgccttcagctttcccgagctgaacaac
ttcttgcgaatcttacagcgcgaggaagaagagcatgtgcggcagattgtgaatcgctat
gctcatgctagagacatgataaggcacgcaatggcccgcgtaactacccctggttga

DBGET integrated database retrieval system