KEGG   Xiphophorus maculatus (southern platyfish): 102226562Help
Entry
102226562         CDS       T02923                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    102226562 (tmprss9)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102226562 (tmprss9)
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102226562 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a Trypsin_2 DUF1986 SEA
Motif
Other DBs
NCBI-GeneID: 102226562
NCBI-ProteinID: XP_023195570
LinkDB All DBs
Position
9
AA seq 778 aa AA seqDB search
MDVSRDGSGGSWPPSPSNTGCHKGIVAVCIILFLIVGIFAGLAIAYLLEEPHDFLETVEL
KGLKYSPDLEDGNSGFSIILSSALKSKVKDIFTASSISKHYYGCSIIAFGVSKIQQYSDN
FFRDLLRAGLSSVLYGKPLEVPGFGQISAIVLLGASGKSFYVIGDEMIARCPENAYTCEN
GECIPKKNPACDFIPDCADASDEARCDCGLRPAMGSRIVGGEDARQGELPWQVSLRYHWR
HTCGASIINERWIISAAHCFEGANNPSEWTALVGANLVNGIEAESKTINIKSIIVNPEYD
PMTSNNDVTVLELETPLTFNSYIQPVCIPPPSHVFEPGQSCIVSGWGALQQFSTHVPNTL
QKALVKIIDSKACNQSSVYRGAITHKMMCAGFLQGKVDSCQGDSGGPLVCEGGPGRFFLA
GVVSWGVGCAQVNRPGVYARVTKLRNFILKYTDPALVNDQVKPVPTIPAPLTSKSSGSLL
VPQSMAMDEPAGVPQPATNCSENFQCGSSLCISKVNPECDRIPDCPNEADEKNCDCGVRP
ALGVQRIIGGVTARRGEWPWTGSLQYQKQHRCGTTLIHKKWLLTAAHCFNSDSSPTEWAV
SLGSVLRSGLGALVIPIQRVIIHPAFNGTNMDHDVALVELAVPAPVSYTIQLVCLPSPTH
IFLENSECYITGWGSMKEGGSLTNLLQKAAVNIIDQEDCQLSYGNVLTPSMMCAGFMAGG
RDTCLGDSGGPLTCRHHSGPWFIAGVTSWGHGCGRTGFPGVYTRVTSVRKWISTHLPF
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcagtagggatggcagtggagggtcgtggccaccctcaccctccaacaccggc
tgtcataaaggcattgttgcagtctgcatcatccttttccttattgtgggcatctttgca
ggcctcgctattgcatacctgctggaggaaccgcatgatttcttagaaaccgtggagttg
aagggactcaagtacagtcctgatctggaggatggaaactctggtttctctataatactt
tcctcagctttaaagtccaaagttaaagatatcttcactgcctcatcgatatcaaaacat
tattatggctgcagcattattgcgtttggggtatccaaaatccagcagtattctgataac
ttttttcgagacctgctgagagcagggctcagctcggtgttgtatgggaaaccactagag
gtgcctgggtttggacagatcagcgctatcgtcttactgggagccagtggaaagtcgttt
tatgtaattggagatgagatgatagcaaggtgtccagaaaatgcttacacttgtgaaaac
ggggaatgtattcccaaaaaaaaccccgcgtgtgatttcatccctgactgtgcagatgca
tctgatgaggctcgctgtgactgcggcttacgcccggcaatggggagtcggatagttggt
ggtgaggacgcccgccaaggcgagctgccctggcaggtcagtctgaggtaccactggagg
cacacatgtggagcctccatcatcaacgagcgctggatcatcagtgcagcacactgcttt
gaaggtgccaacaatcccagtgaatggacagcactggttggagccaacctggtcaacggc
atagaggccgagtcgaaaactattaatatcaagtcgataattgtcaatcctgaatacgac
cccatgaccagcaacaatgatgtgactgtcctggagctggagacgcccctcaccttcaac
tcctacatccagcctgtctgcattccccctccgtcccacgtctttgagcccggtcagagc
tgcattgtgtctgggtggggcgctctgcagcagtttagcacacatgtccctaacacgctg
cagaaagcgttggttaagatcatagactccaaggcgtgcaatcagtcatctgtgtacaga
ggtgctattactcacaaaatgatgtgtgctggattcctgcaggggaaggtggactcctgt
cagggtgactctggagggccccttgtgtgcgaaggcggacccgggaggttctttctggct
ggggtggtgagctggggtgtgggttgtgcccaggtcaacaggcctggagtttacgcccgc
gtcaccaagctcagaaactttattttaaaatacacagatccagctttggtcaatgaccaa
gtaaagcctgttccaacaataccagccccattgaccagtaagtcctctgggagcctccta
gtgcctcagagcatggcaatggatgaacctgctggagtccctcaacctgccacaaactgc
agtgagaacttccaatgtggctccagtttgtgcatcagtaaagtcaacccggagtgtgac
agaatccccgactgccccaatgaagccgacgagaaaaactgtgactgtggagttcgtcct
gcgctgggcgttcagcggatcataggtggagtcacggctcggcggggagagtggccgtgg
actggcagtctgcagtaccagaaacaacatcgctgtggcaccacactcattcacaagaag
tggttactgactgctgcacactgttttaacagtgattctagccccactgagtgggctgta
agcctcgggtctgtgctgcggtctgggttaggcgcgttggttattcccatacagagagtg
atcatccacccggctttcaatggcaccaacatggaccatgatgtggctctggtggagctg
gcagtcccagccccggtgtcctacaccatccagctggtgtgtcttccctcgccgacacat
atcttcctggagaactcagagtgctacatcacaggctggggatccatgaaggaaggaggc
tctctgaccaacttgctgcagaaagctgccgtgaacatcattgatcaggaagactgtcag
ctgtcatatggcaatgtgttgactcccagcatgatgtgtgccggattcatggcgggagga
cgggacacctgcctgggggattctggtgggccgttgacgtgccgccatcactctggcccg
tggtttatcgctggtgtgaccagctggggacacggatgtggacgaactggttttccaggg
gtttatactcgggtgacctctgtcaggaaatggatatcaacacacctacctttttga

DBGET integrated database retrieval system