KEGG   Xiphophorus maculatus (southern platyfish): 102226602Help
Entry
102226602         CDS       T02923                                 

Gene name
lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    102226602 (lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xma03400]
    102226602 (lig4)
Enzymes [BR:xma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102226602 (lig4)
DNA repair and recombination proteins [BR:xma03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     102226602 (lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT_2 BRCT RNA_ligase mRNA_cap_enzyme APG17
Motif
Other DBs
NCBI-GeneID: 102226602
NCBI-ProteinID: XP_005813375
Ensembl: ENSXMAG00000015142
LinkDB All DBs
Position
24
AA seq 909 aa AA seqDB search
MMEGTSKNGAAAAEPSVAAQVPFLHLCTTLEKIQKSKLRPDKSKILGDFIESWRKFHAAL
HKDNPKTIDSFYPAMRLIVPPFERERMAYGIKESMLAKLYIDVLGLPKNGPEASKLLNYR
APTTSQGEAGDFAGMAYFVLKKRCTSQGNLSIKEVNDFLDSVAINNASKQKDQVKKSLLH
LITQSSALEQKWLIRMILKDMKLGVSKETVLQVFHPDAAELYNVNTDLKKVCQQLHDPTV
SLSEVSIELFSAFKPMLAAVANIRNIEKQMGNSPFYLQTKLDGERIQLHKDGDVYKYFSR
NAFEYTQQFGGSPLEGSLTPYIHNVFKSNVVNCILDGEMMAFNPTAGTFMQKGSKFDIKR
LMDDSELQTCFCVFDVLLVNDQKLGKEPLKKRYEVLQTVFTPVKGRIHVVPKTEVGTMQD
VVSALNDAIDNREEGIMVKDPLSIYKPDKRGEGWLKIKPEYVDGLMDELDLLIVGGYWGK
GRRGGMMSHFLCAIAEAAKPGEKPSVFHSFCRIGSGYTMKELYDLGLKLAKHWKVYRKND
PPASILCGVEKPEVYIEPCNSVIIQVKAAEIVGSDMYKTNCTLRFPRIEKIREDKEWHQC
MTLAELDQFRSKASGKLASRHLHIDGDEPQKKKRKLPVKPKKVVGIIDHFKPQDLSGVSK
ETDMFEDVEFCILNGTEGHPKSELEKGVARCGGIVVQNPGRDTYCVVAGVENMRVKNLIS
SNQHDVVWASWLLECLDQKEVVPWQPRHMIHMSPSTREHFAKEYDSYGDSYFVDTDEQQL
REVFSRIDGEQAAMASVGAAQVEERYGWDDLPTSMFRPFTFYFHILDPKSATGATCLDIR
ALEVRYHGGTVAKALEEGVSHVVVEEETRLLELRTLRRRFRKKFKIVRDSWVTDSITAGH
LMDDADYLV
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgatggagggaacttccaaaaatggagcggctgctgcagagcccagcgttgctgctcag
gttcctttccttcacttgtgcacaactttagagaaaatccagaagtccaaactccgtcca
gataaatccaagatccttggggatttcattgaatcatggcggaaatttcatgccgccctc
cacaaggacaatccgaaaactatagactccttctaccctgctatgcgcctcattgtcccg
ccttttgaacgagagcgaatggcctatggcatcaaagagagcatgctagctaagctctac
atcgatgttttaggcctcccaaagaatggcccagaagccagtaagctcctgaactaccgt
gctccgactacatcccaaggagaagcaggggatttcgccggcatggcatactttgtgctg
aagaagcgatgtaccagccaaggaaacctcagtatcaaagaggtcaatgactttcttgac
tcagtggccatcaacaatgccagcaagcagaaggatcaggtgaaaaagagcctgctgcac
ctcatcactcagagctctgctctggagcaaaagtggcttattaggatgattctgaaggac
atgaagcttggagtcagcaaggaaactgttctccaggtcttccacccagacgccgcagag
ctctacaatgtcaacacggacttaaagaaggtgtgccagcagctgcacgaccccactgtg
tctttaagcgaagtctcgattgaactcttctctgccttcaagccaatgttggcagcggtg
gccaacatccgcaacatcgagaagcagatggggaacagccccttttaccttcagacgaaa
ctggatggggagcggattcagcttcacaaggatggagacgtgtacaagtacttcagccgg
aacgcatttgaatacacgcagcagttcggaggatcgccgctcgagggatcactcactcct
tacatccacaacgtgttcaaaagcaacgttgtaaactgcatcctggatggcgagatgatg
gcgttcaacccgacggcggggaccttcatgcagaaagggagcaaatttgacattaagaga
ctgatggacgactctgagctgcagacgtgcttctgcgtctttgacgtgttgctggttaat
gaccaaaaacttggcaaagaaccgctgaagaagcgatatgaggttctccagacggtcttc
acccccgtcaagggtcggatacatgtggtgccaaagacagaagtcggaacaatgcaagat
gttgtcagtgctcttaacgatgccattgataacagggaagaagggattatggtgaaggac
cctttgtccatctacaaacctgataaacgaggggagggttggctgaaaataaagccggag
tatgtggacggcttgatggatgagctggacctgctgattgttggtggttactgggggaaa
ggaagacggggcgggatgatgtcccactttctatgtgctattgcagaagcggcaaagcct
ggtgagaagccgtcggttttccactccttctgccgaattggctcaggttacaccatgaaa
gagttgtatgaccttgggttgaagcttgcgaagcattggaaagtctaccggaaaaatgac
ccaccggcatccatcctctgtggagtggagaaaccggaagtgtacatcgaaccctgcaac
tcagtcatcatccaggtcaaagcggccgagatagttggaagcgacatgtacaagaccaac
tgcaccctgcggttccccagaatcgaaaagatccgcgaggacaaagagtggcaccagtgc
atgactctggcagagctggatcagttccgcagcaaggcgtccgggaaactggcctcgcgg
caccttcacatcgacggcgacgaaccacagaagaagaagcggaagctgcctgtcaaacca
aagaaggtggttggcatcattgaccacttcaagccccaggatctgtccggagtttccaag
gagacggacatgtttgaggatgtggagttctgcatcctgaacggcactgaaggccaccca
aagtcagagctggagaagggcgtggccaggtgtggcggcattgtggtccagaacccggga
cgggacacttactgcgtggttgccggcgtggagaacatgcgcgtgaagaacctgatttcc
tccaatcagcacgacgtggtctgggcgtcatggctgctggagtgcctggatcagaaggaa
gtggtgccatggcaaccgcgccacatgatccacatgtcgccctcgaccagggaacacttc
gccaaggagtacgacagctacggcgacagctactttgtcgatacggacgagcagcagctg
agggaagtgttcagcaggatcgacggggagcaggcggcgatggcgtctgtcggcgcggcg
caggtggaggagcgttacggctgggacgaccttcccaccagcatgttcagacccttcacc
ttttacttccacatcttggatccgaaaagcgcaacaggtgctacctgtctggacatcagg
gcactggaggttcgataccacgggggaacggtggcgaaggcgctggaggaaggagtttct
cacgtcgttgtcgaggaagagacgagactcctggagctgaggacgctgaggcgccgcttc
aggaagaagtttaagatcgttagagactcgtgggtgaccgactccattacggcagggcat
ctgatggacgatgctgactacctggtttga

DBGET integrated database retrieval system