KEGG   Xiphophorus maculatus (southern platyfish): 102227163
Entry
102227163         CDS       T02923                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102227163
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102227163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xma04030]
    102227163
G protein-coupled receptors [BR:xma04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102227163
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1634 7TM_GPCR_Srv 7tm_4 Claudin_2
Other DBs
NCBI-GeneID: 102227163
NCBI-ProteinID: XP_014324775
Ensembl: ENSXMAG00000013835
UniProt: A0A3B5QI03
LinkDB
Position
5
AA seq 366 aa
MSGTNSSVTVCYYNQTVEFFYNNANKKISPSWRKRDYAVVSLGLLVCFIVILSNLLVISA
IFKNRRFHFPIYYLLGNLAVSDLFSGVAYLHLMFHTGPWTMKLSQYQWFLRQGLIDTSLT
ASVLNLLAIAMERHQTIFNMQLHSEMSTRRVFIIIFFIWMVSIIMGLFPTMGWNCLCDLK
RCSTMAPLYSRSFLVFWALINLITFSIMVAIYTRIFFYVRHKSRQMSEHTTPTRHRETVL
GLMKTVSMILGLFVLCWTPGLVLLMLDGLYCETCNVLNYEKYFLVLAECNSFVDPIVYCF
RDKDMRKTFKELLCCLCRRGKGPSDNDFTTLEESRLRTIRKATKTNGTPLMNHVSEDHAA
ASDGFH
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgtccggcacaaattccagcgtcactgtatgctactataatcaaactgtggaatttttt
tacaataacgccaataagaagatttctccatcctggcgcaaacgggactatgcggtcgtc
tctttgggactgcttgtttgcttcatagttatcctttcaaaccttttggtcatatcggcc
attttcaaaaaccgccgctttcacttccccatctactacctgctgggtaatctggctgtt
tcagacttgttttcaggcgttgcctacctccacttgatgtttcacactggcccttggacc
atgaagctatctcagtaccagtggtttcttcgccaagggctaatcgacaccagcctcacg
gcctccgtcctcaatcttcttgctattgccatggagcgacaccagaccatcttcaacatg
cagctgcacagcgagatgagcacgcggcgggttttcatcatcatatttttcatctggatg
gtgtcgattattatgggcctttttcccaccatgggatggaactgtctgtgtgacctgaag
aggtgctccactatggcgccgctctacagtcgcagtttcctggtgttctgggcgcttatc
aacttgattactttctccataatggtggccatctacacccggatcttcttttatgtgagg
cacaagagcaggcagatgtctgagcacacaaccccgaccagacacagagagaccgttctc
ggcttgatgaagaccgtttcaatgatcctaggcctcttcgtgctctgctggaccccgggc
ctcgttctgctgatgctcgacggtctctattgtgaaacatgtaacgtgctgaactacgag
aagtacttcctggtgctggccgagtgcaattctttcgtcgaccccatcgtctactgcttc
agggacaaagacatgaggaaaaccttcaaggagctgctgtgctgcttgtgccgccggggc
aagggcccgtctgataatgactttaccaccctcgaggagtcgaggcttcgtaccatccgg
aaggcgacgaagaccaacgggacgccgctcatgaaccacgtgtcggaggatcacgccgcc
gcctcagacggcttccactga

DBGET integrated database retrieval system