KEGG   Xiphophorus maculatus (southern platyfish): 102227832Help
Entry
102227832         CDS       T02923                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00010  Glycolysis / Gluconeogenesis
xma00051  Fructose and mannose metabolism
xma00052  Galactose metabolism
xma00500  Starch and sucrose metabolism
xma00520  Amino sugar and nucleotide sugar metabolism
xma00524  Neomycin, kanamycin and gentamicin biosynthesis
xma01100  Metabolic pathways
xma01200  Carbon metabolism
xma04910  Insulin signaling pathway
Module
xma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102227832
   00051 Fructose and mannose metabolism
    102227832
   00052 Galactose metabolism
    102227832
   00500 Starch and sucrose metabolism
    102227832
   00520 Amino sugar and nucleotide sugar metabolism
    102227832
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102227832
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102227832
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xma04131]
    102227832
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102227832
Membrane trafficking [BR:xma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102227832
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102227832
NCBI-ProteinID: XP_023189942
Ensembl: ENSXMAG00000008211
LinkDB All DBs
Position
5
AA seq 919 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYAMRFSDETLKDIMGRFRRDMEYGLGRDTNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQVYETPDDIIH
GSGTQLFDHVAESLGDFMEKQKIKDKRLPVGFTFSFPCVQSKLDEAILVTWTKKFKANGV
EGMDVVKLLNKAIKKRGDYQADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMASGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKTKEGLKKCMEILTRLG
VEPSDEDCLAVRHVCTIVSFRSANLISASLGAILSRLKDNKGVARLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLTDQARQIQETMAEFRLS
KGQLLEVKKRMRMEIERGLKKETHKEATVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCHQTSLDAGILVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEELKNIEIVGGTEGRMCVNMEWGAFGDNGCLDD
IRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGAGMAA
VVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIFHQTVKELAPKCDVNFLLSEDGSGKG
AALITAVGCRQRELDAQQH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctcagcttctggcctactacttcaccgagctgaaggatgatcagctcaag
aagattgataagtacctctacgccatgcgtttctctgatgagacgctgaaggacatcatg
ggccgtttccgtagggacatggagtacggactcggccgtgacacgaatcccacagcgacg
gtgaaaatgctgcccaccttcgttaggtccatccctgatggatcagaaaagggagacttc
atagctcttgatcttggtggatcaaactttcggatcttgcgtgtcaaagtgacacaggac
aagaagcagccagttcagatggagagccaggtctatgaaactcctgatgacatcatccat
gggagtgggacacagctctttgaccatgtcgctgagtccctgggtgattttatggagaaa
caaaaaattaaggataaaagactacctgtgggatttacgttctcattcccctgtgtccaa
tccaaactggatgaggccatccttgtgacttggacaaagaagtttaaggctaatggtgta
gagggaatggatgttgtgaaacttctcaacaaggcaattaagaaacgaggggactatcaa
gcagacatcatggcagtggtgaacgacacagttggcaccatgatgacatgtggatttgat
gatcagcgttgtgaagtgggaatcattataggtacggggacaaacgcctgctacatggag
gaactgcgacacattgatctggtggaaggagatgaaggccggatgtgcattaacaccgaa
tggggggcatttggggatgacggctctttggaagacattcgtacagaatttgatcgagag
attgacagaggttccctcaacccaggaaagcaattgtttgagaagatggccagtggaatg
tacatgggagagctggttcgactcatcctggtgaaaatggccaaggaggggctcctgttt
gagggaagaatcactcctgagcttctgaccaaaggaaagatcgaaacaaagcatgtctct
gccatagagaagactaaagaaggactgaagaaatgtatggaaatcctgaccagacttggt
gtggagccatcagatgaagattgcctggccgtcaggcatgtatgcaccattgtgtccttc
cgctctgcaaatctgatttctgcgtctctgggagctatcctctcacgcctaaaggacaac
aaaggagttgcacgccttcgcactactgtgggaatcgatggttctctctacaaaatgcac
cctcaatacgcccggcgcttgcacaagaccgtacgtcgtttggttccagactctgatgtc
cgcttcctgctgtctgaaagtgggagtggcaaaggtgctgctatggtgacagcagtggcc
taccgtttgaccgaccaggcgcgccagattcaggagactatggcagagttcaggttgagc
aaaggtcaactgctggaggtgaagaaacgcatgagaatggaaatcgaaagaggcctgaag
aaggagacccacaaggaggcgacagtcaaaatgctgcctacatttgttcggagtacacca
gatggaacagaaaatggagattttctagctctggaccttggaggaacaaacttccgtgta
cttttggttaagattcgcagtgggaagaagcgcacagtagaaatgcataacaaaatctac
gccattcccatagaagtcatgcagggcacaggagaggagctttttgaccacattgtgcac
tgcatctccgacttcctggactacatgggaatgaaaagcgctcgactgccgctgggtttc
accttctctttcccctgtcaccagaccagcctggacgcaggtatcctggtaacctggaca
aaaggcttcaaggcaacagactgtgaaggtgaagatgttgtggagcttctccgagaagca
atcaaaagaaaagaggagtttgagctggatgtggttgccatagtgaacgacaccgtggga
acgatgatgacctgtgcgtacgaagagccaacgtgtgaagtcggactgattgcaggcaca
ggaagtaacgcctgctacatggaggagctgaagaacattgaaatagtgggaggcactgag
ggtcggatgtgcgtcaacatggagtggggggcgtttggagataacggctgtctggacgac
atcaggacgaaatatgatcaggcggtggacgaaaactcactcaacgaaggaaaacagaga
tatgagaagatgtgcagtggaatgtatttgggagaaatcgtgcggcagattttgattgat
ctgacgaagcgtggtttcctcttccgaggacagatttcagagacactgaagactcgcggc
atctttgagaccaaatttctgtcacaaatagagagcgatcgtctggcgctgctgcaggtc
agagcgattctgcagcagctgggactcgacagcacctgtgatgacagtattatcgttaag
gaggtgtgtggaacggtgtcccgccgcgccgctcagatctgcggagccggaatggccgcc
gtggtggacaagatccgtgagaaccgaggactggaccacttggacatcaccgtgggtgtg
gacggcacgctctacaagctgcacccacacttctctcggatcttccaccagacagtaaaa
gaacttgcccctaaatgtgatgttaacttcctgctatcggaggacggcagtggcaaggga
gctgctctcatcactgccgtgggctgccgccagagggagctagacgcccagcaacactga

DBGET integrated database retrieval system