KEGG   Xiphophorus maculatus (southern platyfish): 102228489Help
Entry
102228489         CDS       T02923                                 

Gene name
nsd2
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2 isoform X1
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102228489 (nsd2)
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102228489 (nsd2)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102228489 (nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET PHD zf-HC5HC2H_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 102228489
NCBI-ProteinID: XP_023208952
Ensembl: ENSXMAG00000008116
LinkDB All DBs
Position
19
AA seq 1312 aa AA seqDB search
MSCSVSVDGSDGMDSIGSSLPAMPEPSNPISMKQPPESLSTLKGRADMGSDPALLMDKAA
AQLAATLQDGVLQKMSGHNHSHERLKDLTSLVLNGDQDALPKLCTPEPPMLKGDEAPATN
DAHQHNRTPHDEAELKATVPAAAEQPPLEPSCADGAGLVTATESASPGPDLGQEAKKRRG
RPNKPKLILNRSSVSAMETPDHTEVIGETDAANEPTAVSKQPEPITEEGPVPTRFCVGDL
VWTKVSGYPWWPCMVTTDPELNSHFKQKQKAFNSRLGLLYHIQYFGDAPERGFVFEKNMV
SFTGEEQYVELSQRNKPPASSAAHRKMAPSVPRNLQAQWNMGVIQAKEAVGMAPDQRIDS
FGFTYDRDGPHLNPLILEKLNMDPTDETHRATEPRLGPDVPSLPNPVAFPSDARTSESQK
KKRRPKVAQRPVKLARKKKASSVNGVVVPKRRRKAKPLTTTNDPEDALPQIALLGREQKK
RRKRPLADPAADKDQQPRKRRRTGKKEEKQASVSEETNKKWRRKKKTDIKDLKEPRKRTK
KSKDEQNVEKPKRRRKRRQDGENQAGASKTPKKRRSSPCPDTEGSASEERPDSPSDSLDG
TKKGERKKEFVCQVCEVAGEDLVACEGQCCGMFHLHCLGGTLKPDDKLLCQECSMGLHSC
FICKQSEAEVRRCHVPHCGKFYHEGCVRLNPLTVFDNKGFRCPLHTCLSCHYGCRTKQKA
TKGRLMRCLRCPVAYHVGDLCVAAGSETITNTAIICTNHFNAKKGYSHHSHVNVSWCFVC
SKGGQLLCCESCPAAFHPDCLNIAMPDGSWFCNDCRAGKKPKYRDIIWVKLGTYRWWPAE
IHHPKNVPTNIQHLRHEIGEFPVFFFGSKDYFWTHQGRVFPYMEGDRGSKYQKNGIGKVF
KNALLEAEARFKEIKIKREAKEAQENSRKPPPYKFIKVNKPFGKVQVYTADISEIPKCNC
KPADERPCGFESECLNRMLQYECHPQVCPSGERCCNQDFTKRLYPDTKIIKTPGKGWGLI
ALRDIKKGEFVNEYIGELIDEEECRARIKYAHENNITDFYMLTIDKDRIIDAGPKGNYSR
FMNHSCQPNCETQKWTVNGDTRVGLFAVCDVPAGTELTFNYNLDCLGNEKTICRCGAPNC
SGFLGDRPKNSNGHTEPKGKRFKRKYRRRKSEGKKKSEDECFRCGDGGQLVLCDKKNCTK
AYHLSCLNLTKRPFGRWDCPWHHCDVCGKNSEAFCQLCPNSFCRAHQEGALRPGAAAGEL
CCGEHDDAERGAGQARTAGSESAAAAGRSKGCRKADGAESRTKGSKRKAPEA
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgttcggtgagcgtggacgggtcagatgggatggacagcatcggtagctcccta
cctgcaatgcctgaaccatccaatccgatcagcatgaagcagccgcccgagtccctgagc
accctgaagggccgggcggacatgggcagcgacccggctctgctgatggacaaagccgcc
gcgcagctcgccgccacgctccaggacggcgttctccagaagatgtccggccacaaccac
agccacgagaggctgaaggacctcacctccctggtgctgaacggcgaccaggacgctctg
cccaagctctgcaccccagagccgcccatgctgaaaggcgacgaggcgcccgccaccaac
gacgcccaccagcacaaccgcacgcctcatgacgaggccgagctgaaggcgaccgtaccg
gcggcggcggagcagcccccgctggagccttcctgtgcagacggggccggcttggtcaca
gccacagagagcgcttcacctggtcctgacttgggacaggaagcgaagaaaaggaggggg
agacccaacaaacccaaacttattctgaaccgcagctctgtcagcgccatggagacacct
gaccacacagaggttattggagaaacagacgcggcaaatgagcccacggccgtgtccaaa
cagccggagccgataacagaagagggccctgtacctacgcggttctgcgtgggggatctg
gtttggaccaaggtgtcggggtacccatggtggccctgcatggtgaccacagacccagaa
ctcaacagtcacttcaaacagaaacagaaagccttcaacagcaggttaggcctcctttac
cacatccagtattttggtgacgctccagagagaggctttgtctttgagaagaacatggtg
tccttcactggggaggagcagtatgtggagctcagccagagaaacaaaccaccagcctcc
agcgctgcacatagaaagatggctccctcggttccccgtaaccttcaggctcagtggaac
atgggcgtcattcaggccaaagaggctgtcggcatggcaccggaccagcgcatcgacagc
tttgggtttacttacgacagggacgggccccatctgaaccctctcatcttggaaaagctg
aatatggatcccactgacgagacgcaccgagcgacggaacccaggctgggcccggacgtc
ccctccctgccgaatcccgtagcttttccttcagatgcacgaacttctgagtctcagaag
aaaaagcgacggcccaaagtggctcagcgtcccgtcaagctagcgaggaaaaagaaagcg
tcttcagtcaacggtgttgttgtccccaagaggagaaggaaagctaagccgctcacgact
actaatgacccagaggatgccttacctcagattgctcttctagggagagagcaaaagaag
aggcgtaaaaggccgctagcagaccctgcagcagacaaggatcagcagcccagaaagaga
cgaagaactggcaagaaggaagaaaagcaggcctcggtttcagaggagacaaacaaaaag
tggagaagaaagaagaaaaccgacattaaagatctaaaagaaccaagaaagcgaacaaag
aagtcaaaagatgagcagaatgtggaaaagccaaagcggcggaggaaaagaaggcaggat
ggagagaaccaggccggcgcctccaagactccaaagaagagacgctcctctccctgtcct
gacactgagggttctgcaagtgaagaacgtcccgattctccaagcgacagcctagacggg
acaaagaaaggcgaaaggaaaaaagagtttgtctgtcaggtgtgtgaagtggccggtgag
gacctggtggcatgtgaaggccagtgctgcggcatgttccacctgcactgtctgggtgga
accctgaaacccgacgacaagctgctatgtcaagagtgcagcatgggactccactcgtgt
ttcatctgcaagcagtctgaggccgaggtgcggcgctgccacgtcccccactgcggcaag
ttttaccacgagggctgcgtccgcctcaacccgctcaccgtgttcgacaacaagggcttc
cgctgcccgctccacacctgcctcagctgccactacggctgccgcaccaagcagaaggct
accaaaggacggctgatgcgctgcctgcgatgccccgtggcgtaccacgtgggcgacctg
tgcgttgccgccgggagcgagacgatcacaaacacggccatcatttgcaccaaccacttt
aacgccaagaagggctacagccaccacagccacgtcaacgtcagctggtgcttcgtttgc
tccaaaggaggacagctgctgtgctgcgagtcgtgccctgcagcgttccaccccgactgc
ctcaacatcgccatgcccgacgggagctggttctgcaacgactgccgagccggcaagaaa
ccaaagtacagagacatcatatgggtcaagctggggacgtacaggtggtggccagcagag
atccaccaccccaaaaacgtccccacaaacatccagcacctccggcacgagatcggagag
ttcccggtcttcttcttcggctccaaggattacttctggactcaccagggccgagtgttt
ccctacatggaaggagacagaggcagcaagtaccagaagaacgggataggcaaagtcttt
aagaacgctctgttggaggccgaggctcgatttaaggagatcaagataaaacgggaagcc
aaggaagctcaggaaaacagccggaagccgcctccgtacaaattcatcaaggtcaacaaa
cctttcggcaaggtccaggtctacaccgccgacatctccgagatccccaagtgcaactgc
aagccggccgacgagcgcccgtgcggcttcgagtcggagtgcctgaaccgcatgctgcag
tacgagtgtcacccccaggtgtgtcccagcggggagcgctgctgcaaccaggacttcacc
aagcgcctttatccagacaccaagatcatcaagaccccaggcaagggctgggggctgatc
gccctgagagacatcaagaagggtgagtttgtgaacgagtacatcggggagctgatcgat
gaggaggagtgcagggccaggatcaagtacgcccacgaaaacaacatcaccgacttctac
atgctcaccatcgacaaggaccgaatcattgacgcaggcccaaaaggaaactactcccgc
ttcatgaaccacagctgccagcctaactgtgagactcagaagtggactgtgaacggagac
acccgcgttggcctgttcgcagtctgcgacgtaccggcaggaacagagctgacctttaac
tacaacctggactgcctcggcaacgagaaaaccatctgccgctgcggcgctcccaactgc
agcggcttcctcggggatcggcccaagaactcaaacggccacacggagccaaagggaaag
cgctttaagaggaagtacaggaggaggaaaagcgagggaaagaagaagtccgaagacgag
tgttttcgctgtggagacggagggcagctggtgctctgcgacaagaagaactgcaccaaa
gcttaccacctgtcctgcctgaacctcaccaaacgaccatttggccgctgggactgcccc
tggcatcactgtgacgtctgcgggaaaaactcggaggccttctgccagctctgccccaac
tccttctgcagggcccaccaggagggggcgctgcgccccggggccgcggcgggagagctc
tgctgcggcgagcacgacgacgcggagagaggagccggccaggcccggactgccggctcg
gagtccgccgccgccgccggccgctccaaaggctgcaggaaggcggacggagcagagagc
agaaccaaaggctctaagaggaaagcaccggaagcctga

DBGET integrated database retrieval system