KEGG   Xiphophorus maculatus (southern platyfish): 102228682Help
Entry
102228682         CDS       T02923                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00010  Glycolysis / Gluconeogenesis
xma00053  Ascorbate and aldarate metabolism
xma00071  Fatty acid degradation
xma00280  Valine, leucine and isoleucine degradation
xma00310  Lysine degradation
xma00330  Arginine and proline metabolism
xma00340  Histidine metabolism
xma00380  Tryptophan metabolism
xma00410  beta-Alanine metabolism
xma00561  Glycerolipid metabolism
xma00620  Pyruvate metabolism
xma01100  Metabolic pathways
Module
xma_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102228682 (aldh2)
   00053 Ascorbate and aldarate metabolism
    102228682 (aldh2)
   00620 Pyruvate metabolism
    102228682 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102228682 (aldh2)
   00561 Glycerolipid metabolism
    102228682 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102228682 (aldh2)
   00310 Lysine degradation
    102228682 (aldh2)
   00330 Arginine and proline metabolism
    102228682 (aldh2)
   00340 Histidine metabolism
    102228682 (aldh2)
   00380 Tryptophan metabolism
    102228682 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102228682 (aldh2)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102228682 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102228682
NCBI-ProteinID: XP_023186340
Ensembl: ENSXMAG00000003210
LinkDB All DBs
Position
3
AA seq 517 aa AA seqDB search
MLRTVLSRGITSLIRRSVSYYGTAVPVPSAQPEVHFNKLFINNEWQEAVSGKTFPTINPS
TEEIICQVAEADKADVDKAVKAARNAFRLGSPWRRMDASDRGRLLYKLADAIERDSAYLA
ELETLDNGKPYVISYMADLPLVVKCLRYYAGWADKWEGKTIPVDGDYFTYTRHEPVGVCG
QLIPWNFPLVMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNILPG
MGPTAGAAIANHMDVDKVAFTGSTEVGHLIQQAAGNSNLKKVTLELGGKSPNIILSDANL
ENAVEQSHIGLFFNQGQCCCAGSRVFVQSDVYDEFVERSVARAERRVVGDPFDFKTEQGP
QIDQEQFKKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMIIAREEIFGP
VMQIFKFKTLEEVITRANDTKYGLAASVFTTDIDKANYVSSGLRAGTVWINCYNVFASQA
PFGGYKASGNGRELGEYGLEAYTEVKTVTIKVPQKTS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcacagtgctttcccggggtattactagcctgatccgacgctcagtctcctac
tatgggaccgctgttccggttccgagcgctcagcctgaggtccatttcaacaagctgttt
attaacaatgaatggcaggaagctgtgagtgggaaaacctttcctacgatcaatccatcc
actgaagaaatcatctgccaggttgcagaggctgataaggcagatgtagataaggcagtg
aaggccgcacgtaacgcctttaggctgggctcaccttggcgccgtatggatgcatctgat
cggggcagacttctttacaaattagccgacgctattgaaagagattctgcctacctcgct
gaactggagaccttggacaacgggaagccgtatgtcatttcctatatggctgatttaccc
ttggttgtgaaatgtctcaggtactatgcaggttgggcagacaagtgggaggggaagacc
atccctgttgatggagattacttcacctataccagacatgaacctgttggagtctgtgga
cagctaataccttggaacttccctctggtgatgcaggcctggaaacttgggccagcctta
gcaactggtaatactgtcgtgatgaaagtagctgagcaaacaccactcacagcactctat
gtggccagtctcattaaagaggttggatttcctgaaggcgtggtcaatatcttgcctgga
atgggaccaacagctggtgcagccattgccaaccacatggatgttgacaaggtggccttt
actgggtccacagaggtgggtcatctgatccaacaggcagcaggcaacagtaacctgaag
aaagtcacattagaactgggaggaaagagtccaaatatcattctgtctgatgccaacttg
gaaaatgctgtggagcagtcccacattggcctgtttttcaatcaaggccagtgttgctgt
gctggctctcgagttttcgtccaatcagatgtctacgatgagtttgtggagcgcagtgtg
gcacgtgctgaaagaagagtggtgggagacccgtttgacttcaagactgagcagggccct
cagatagatcaggagcagttcaaaaagattctgggctacatcagcagtgggaagagagaa
ggtgccaaactgatgtgtggaggaggagtggcagcagacagaggctacttcatccagcct
acagtgtttggagatgtccaggacaacatgatcattgccagggaggagatttttggtcca
gtgatgcagatctttaaatttaaaacactggaggaggttataaccagagccaacgacacc
aaatatggacttgcagcttcagttttcacaactgacattgacaaagcgaactatgtttcc
agtgggctccgggctggcacagtctggataaactgttacaacgtgtttgcttcccaggct
ccatttggaggctacaaagcctcaggtaatggcagagagttgggagagtatggactggaa
gcctacacagaagttaaaacggtgacaatcaaggtgccacagaagacttcttaa

DBGET integrated database retrieval system