KEGG   Xiphophorus maculatus (southern platyfish): 102228793
Entry
102228793         CDS       T02923                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
xma04115  p53 signaling pathway
xma04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102228793
   04068 FoxO signaling pathway
    102228793
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102228793
   04115 p53 signaling pathway
    102228793
   04218 Cellular senescence
    102228793
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102228793
NCBI-ProteinID: XP_005797261
Ensembl: ENSXMAG00000004302
UniProt: A0A3B5Q8R1
LinkDB
Position
17
AA seq 178 aa
MMMASTSASSGGTMKSESETSTLQGIDALKLKVGPVRRNLFGPVDHQQLQRDFQQLLRMS
VEVANKRWNFDFQRDVPGEGADVQWVELGCQDVPAFYRTCLVRPGVLARKITRSTSTSSM
EEDGSPVSESSSGEEYLEVTTRGSYPIRRLGKRRQSAITDFFKVKKRKLMPSKASSQQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgatgatggcttctacgtcagcatcgtccggaggaaccatgaagtctgagtccgagacc
tcgactctccaaggcatcgacgccttgaagctgaaggtagggccggtgcggagaaacctc
ttcggccctgttgaccaccagcagctccagcgggacttccagcagctgctccgcatgagc
gtggaggtcgccaacaagcgctggaactttgacttccagagagacgtgccaggagagggc
gccgacgtgcagtgggtggagctcgggtgccaggacgtgccggcgttttaccggacctgc
ttggtgaggcccggggtgttggccagaaaaatcacgaggagcacctcaacgtcgtccatg
gaggaagacggctctcctgtctctgagagctcgtctggggaagaatacctggaagtgacc
actagagggagctacccaattcggcggctgggaaaacgcagacaatctgcaatcacagat
ttctttaaggtgaagaagaggaaactcatgcccagcaaagcttcctctcagcagtag

DBGET integrated database retrieval system