KEGG   Xiphophorus maculatus (southern platyfish): 102228898Help
Entry
102228898         CDS       T02923                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00590  Arachidonic acid metabolism
xma01100  Metabolic pathways
xma04370  VEGF signaling pathway
xma04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102228898 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102228898 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102228898 (ptgs2)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102228898 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102228898
NCBI-ProteinID: XP_023195548
Ensembl: ENSXMAG00000002418
LinkDB All DBs
Position
9
AA seq 665 aa AA seqDB search
MKMEEALLGTRLPLIGNRSEWAATSEYKCSVRSALPLIYFSQTKRPARKKKRVHSRMDLF
LTLAALLLATSVSLCNGGNPCCSEPCQNRGVCTAMGSENYECDCTRTGFYGQNCTTPEFL
TWIKVSLKPSPNTVHYILTHFKGFWNIINNISFLRDAIMKYVLTSRSHMIDSPPTYNADY
GYKSWEAYSNLSYYTRALPPVPADCPTPMGVVGKKELPDVKVLAEKLLVRRRFIPDPQGT
SLMFAFFAQHFTHQFFKSDMKNGPAFTVAKGHGVDLGHIYGENLEKQHKLRLFKDGKLKY
QMIKGEVYPPLVKDVGVEMHYPPHVPDSQRFAVGHEAFGLVPGLMMYATIWLREHNRVCD
VLKEVHPDWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFSKRFQYQ
NRIASEFNTLYHWHPLMPDSFHVEERDYSYKEFVFNTTVMTEHGINNLVDSFTKQTAGRV
AGGRNVPGPILYVAIKSIENSRKMRYQSLNAYRKRFSMKPYTSFEDMTGEKEMAAILEEL
YGDVDAVELYLGLLVEKPRSNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGSV
GFDIVNTASLQRLVCNNVQGPCPVASFYVPDIKETGSMTINSSTSQSRGSNPNPTVILKE
RTSEL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggaggaggcgcttctcggcacccgacttccgttaataggtaataggtcagag
tgggcggcgacttcagagtataaatgtagcgtcaggtctgcgttgcctcttatttacttc
tcgcagacaaagagaccggctcgcaaaaagaagagagtacatagcagaatggatcttttc
ttaacacttgctgctttactgctggcaaccagcgtttctttatgcaatggaggtaacccc
tgctgctcagagccatgccagaacaggggtgtgtgcacagcgatgggttcagaaaactat
gaatgcgactgcacacgcactggtttttatggacaaaactgcacaacacctgagttcctc
acttggataaaggtttccctaaagccttcacccaacacggtgcactacatcctcacccac
ttcaagggtttctggaacatcatcaacaatatctcatttctcagagatgccatcatgaaa
tatgtcttgacatcacgatcccatatgattgacagtcctcctacttacaatgcggattat
ggatacaaaagctgggaagcctattccaatctgtcctactatacccgtgcccttcctcca
gttccggctgattgcccaacccctatgggagtcgtaggtaaaaaggagctacctgatgtc
aaggttttggcggaaaagctcttggtgaggagacggtttattccagacccgcagggtacc
agcttgatgtttgcgttcttcgcgcaacacttcacacaccagttcttcaagtctgatatg
aagaacggacctgctttcacagtggctaaaggccacggggttgatctcggccacatttat
ggtgaaaacctggagaagcaacataaactgaggcttttcaaggacggaaagcttaaatat
cagatgataaagggagaggtgtaccctccactggttaaggatgttggtgttgaaatgcac
tacccgccacacgtcccagactctcagcgcttcgctgttggccacgaggcgttcggtctg
gtcccaggcctcatgatgtacgccaccatctggctccgtgagcacaaccgggtgtgtgac
gttttgaaggaagttcacccagactgggatgacgaaagactctttcagacctctcggctc
atccttattggtgagaccatcaagattgtgattgaggactacgtgcagcacctgagcgga
tatcacttcaaactgaagtttgacccagagctgctcttcagcaaacgcttccagtaccaa
aaccgcatcgcatcagagttcaacactctttaccactggcaccctctgatgcctgacagc
ttccacgtcgaggagagggattacagctacaaagagtttgtcttcaacaccactgtgatg
accgagcacggcatcaacaacctggtggattcatttaccaagcagactgcaggacgggtc
gctggtgggaggaacgttccaggacccatcttgtatgtcgccatcaagtccatcgagaac
agcagaaaaatgcgctaccaatccctcaatgcctacaggaagagattctccatgaagccc
tacacctcgtttgaagacatgacaggagaaaaagaaatggccgccatactggaggagctg
tatggagacgttgacgctgtggagctctacctcggcctgctcgtggagaagccccggtcg
aacgccatttttggggagacgatggtggagatgggggctcctttctccctcaaaggcctg
atggggaatcccatttgctcaccagagtactggaagcccagcacctttggaggctcagtc
ggctttgacatcgtcaacaccgcctccctgcagaggctagtttgcaacaacgttcaaggt
ccctgtccagtggcgtccttttacgtgcctgacatcaaagagaccggatccatgaccatc
aactcgagcacgtcgcagtcgcgcggcagtaaccctaaccccacagttattctgaaagaa
aggacttctgagctctaa

DBGET integrated database retrieval system