KEGG   Xiphophorus maculatus (southern platyfish): 102229588Help
Entry
102229588         CDS       T02923                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102229588 (mapk6)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102229588 (mapk6)
Protein kinases [BR:xma01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102229588 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 102229588
NCBI-ProteinID: XP_005799793
Ensembl: ENSXMAG00000002154
UniProt: M3ZIW5
LinkDB All DBs
Position
4
AA seq 754 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPCGRRLTEDVASLTEVNSVYIVQEYMETDLCQLLE
RGPMSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFSEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDRQELHSVIPVFIRSDMSKPHTPLVNLLPGVSPQAMDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPISLHPFHIEDEVDDIVLMDESHSHTWERYHESQF
SEADWQLHSTHDPDEVQVDPRALSDVTDEEEVQVDPRKYTDGDREKFRDEPSFDYSTLLP
SERSWQEDHHENKYCDVQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSNWKE
QQSKEKADRKAKSKCEKNGLVKAQIALKEAEKTQSPAEKDSEQEKHQAERQQNQGFDFDS
FIASTIKLSLQPEPCPEVTLLSEVGLLNELNFSVSQLEAPRSTSMSKTISQEKEEKCLVN
LAQLGGGGLGVVAGDCVWPTEPWESFGPGESLGDGGCLIDEACWDLRKADQLQKESSYTS
YLDRFFSRKDDSVAEGVTGLEMEPSVVKELDDSFLDTSAEIVLNMQLDSLALPVFDGPDD
LPLKSIQASLSPCAVKCSPQIAHKTYSSIFKHLN
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgagtcactcatgaatatccatgggttcgacctgggatctcgctac
atggacttgaaacctctgggctacggcgggaacggcctggtgttctcggcggtcgatacc
gactgtgacaagcgcgtggcagtaaagaaaattatcttgaccgatcctcaaagtgtgaag
catgccctgcgggaaatcaagatcatccgaagacttgatcatgacaacattgtcaaggtt
tttgagaccctaggcccctgcggccgcagactaacggaggatgtggcgtcgctcacagag
gtgaactcagtctacatcgtgcaagagtacatggagactgacctctgtcagctgctggag
aggggccccatgtctgagggccacgcacggctcttcatgtaccagctcttaaggggcctt
aagtacatccactcagccaatgtgcttcaccgtgacctcaagcctgccaacctatttgtc
aacacggaggatctggtactcaagattggagactttgggctggcccgcattatggatcct
cactactcccacaagggccatttgtctgaaggtctcgtcacaaagtggtaccgatctcct
cgcctgctgctctcaccgaacaactacaccaaagccattgacatgtgggcggctggctgc
atcttttccgagatgctcactgggaaaactctttttgcaggagcacatgaactggagcag
atgcagctgatcctggaatccatcccagtgctgcgagaggaagaccggcaagagcttcac
agcgtcatccctgtcttcatccgcagcgacatgtcaaagcctcacacgccgctggtcaac
ctgctgcctggtgtcagcccacaggccatggattttctggagaagatcctcacctttaac
cccatggaccgtcttactgccgaagaggccctggcccacccctatatggccgactactcc
ttccccctggatgagccgatctctctgcacccctttcacattgaagacgaagtagatgac
atcgtgctcatggacgagagccacagccatacctgggaaaggtatcatgagagccagttc
tcagaggctgattggcagttgcacagcacccatgacccagatgaagttcaggttgacccc
agggcgctctctgacgttacagatgaagaggaggtccaggtcgatcctcgtaaatacacc
gacggcgatcgggagaagttccgggacgagccttccttcgactactcgaccctgctcccg
tcggagcggtcttggcaggaagaccaccacgagaacaagtactgtgatgtgcagtgcagt
cacacttgcaactacaaggccgtgtccccctcctacctggacaacctcatctggagggac
agtgaagtcaaccactactacgaacccaagctcatcatcgacctgtccaactggaaggag
cagcagagcaaggagaaggccgaccgcaaggccaagagcaagtgcgagaagaacgggctg
gtgaaggcgcagatcgccctgaaggaggccgagaagacccagagtccggccgagaaggac
agcgagcaggagaaacaccaggcggagaggcagcagaaccaaggcttcgacttcgactcc
ttcatcgccagcaccatcaagctgagcctgcagccggagccgtgtccggaggtgaccctg
ctcagcgaggtgggcctcctcaacgagctcaacttctccgtctcccagctggaggcgccc
cgctctacttccatgtcaaagaccattagtcaggagaaagaggagaagtgcctagtgaac
ctcgcccagttgggcggcgggggtctgggagtggtggccggggactgcgtctggcccacc
gagccctgggagagcttcggacccggggagagcctcggcgacggcggctgtctgatagac
gaagcgtgctgggacctccgcaaggcggaccaactccagaaggagagctcctacaccagc
tacctggaccgcttcttcagccggaaagatgacagcgtcgccgagggcgtgactggcttg
gagatggagccctcggtggtgaaggagctagacgacagcttcctggacactagcgcggag
atcgtgctcaatatgcagctggactctctggccttgcccgtgtttgacggccccgacgac
ttgcctctaaagtccatccaggcgtccctctccccttgtgccgtcaaatgttcccctcag
atagcccacaaaacctacagcagcatcttcaagcatcttaattaa

DBGET integrated database retrieval system