KEGG   Xiphophorus maculatus (southern platyfish): 102230210Help
Entry
102230210         CDS       T02923                                 

Gene name
sod1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:xma00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102230210 (sod1)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102230210 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 102230210
NCBI-ProteinID: XP_005807113
Ensembl: ENSXMAG00000017597
UniProt: M4AT47
LinkDB All DBs
Position
11
AA seq 154 aa AA seqDB search
MVLKAVCVLKGAGETTGTVHFEQENESAPVKVTGEISGLTPGDHGFHVHAFGDNTNGCIS
AGPHYNPFTKNHGGPTDVERHVGDLGNVTAGADNIAKIDIKDTFIKLSGPNSIIGRTMVI
HEKADDLGKGGNEESLKTGNAGGRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcaaagccgtgtgtgtcctaaaaggagctggagaaaccactgggacggttcac
tttgagcaggagaatgagtcagctcctgtgaaagttactggagaaatcagtggcctcaca
cctggtgaccatggtttccatgtccatgcgtttggagataacacaaatgggtgcatcagt
gcaggaccacactacaatccctttacaaagaaccatggtggtcctactgatgtggaacga
cacgttggagatttggggaatgtgactgctggtgctgacaatatagccaagattgatatt
aaagacacttttatcaagctctcagggcccaactccattattggcagaactatggtgatc
catgagaaggctgatgatcttggaaaaggaggaaatgaagaaagcctcaagacgggtaac
gctggcgggcgcctggcctgtggagttattggcattgcccagtaa

DBGET integrated database retrieval system