KEGG   Xiphophorus maculatus (southern platyfish): 102230290
Entry
102230290         CDS       T02923                                 

Gene name
cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04020  Calcium signaling pathway
xma04260  Cardiac muscle contraction
xma04261  Adrenergic signaling in cardiomyocytes
xma04270  Vascular smooth muscle contraction
xma04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102230290 (cacna1c)
   04020 Calcium signaling pathway
    102230290 (cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102230290 (cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102230290 (cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    102230290 (cacna1c)
   04270 Vascular smooth muscle contraction
    102230290 (cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xma04040]
    102230290 (cacna1c)
Ion channels [BR:xma04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102230290 (cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 102230290
NCBI-ProteinID: XP_023205971
LinkDB
Position
17
AA seq 2322 aa
MVNESKNMYIPEDTLENHQGSDYSPPPLPRPPPVGLTNEHRGGGNHGDHSGGGGGVNRGV
GVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASGGGAGLGSGGGGPISTASSTQRK
RQHYASKPKKQTTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVAL
AVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFI
IVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSI
IKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCIYNHSGTNAEEKPAPCAPDGAYG
RHCMQNGTKCQVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPW
VYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWIT
QAEDIDPENEEEGLDDDKPRNLSMPASENESVNTDNAPGGDVEGETCCTRLAIRISKSKF
SRYSRRWNRLCRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHKQPQWLTDVQDIANKV
LLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCV
RLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDDT
RRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYIL
LNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPEKRQDNEKPPIEEKKCEKIE
LKSITSDGETNTATKINMDDCCGDENEEKNPYPVNDYIGDEDEEEPEMPVGPRPRPLSDI
QLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKN
DSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSG
IQLDFSTSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQ
FMFACIGVQLFKGKFFYCSDSSKQTQAECRGSYIMYKDGDVGKPGKAQRIWENSDFNFDD
VLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNI
FVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTY
FEYLMFTLILLNTICLAMQHHGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFS
DPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSIVDIAITEVNPADSSSSS
SSSSSSSSSSSSSSHPHVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDNTQINRNNNFQTFPQAVLLLF
RCATGEAWQEIMLACSPKHPCEKGSTNENSTTHDDCGSQFAIIYFVSFYMLCAFLIINLF
VAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFG
KLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIVKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVAKVPPKTALSL
QAGLRTLHDIGPEIRRAISGDLNVEEEIDKGMKESVSAASEDDIFRVKRTGGLFGNHVNY
YNQSDGRGSFPQSFTTQRPLHISQKGSPCEGESPSHEKLMDSTMFTPSSYSSSGSNANIN
NANNTGMTGVTTQGVSRFPSPSISTVDGHTGQPLTPILLPRSAWCFPPKRMFYDTLMRSD
SSDSRLPIIQRGEGSTEETYDESYGDDRVYEDDEHSLSSDMLVYHDETCKQLTPMEEAEE
VEEKKGGGGWQSPRRVFFCPTTLARRSSFHLECLRRQTRPDVSQKTAVPLHLAHHQALAV
AGLSPLLRRSHSPTLFSRLCSTPAANPTDQCSDASYQRVPSLRLEGSNSHEKLNTSLPSV
NCGPWYNDSNGNSPVDSPSPTPASSQRAPRPVSLTVPSLLGKDPSSLSHGSAGSLVEAVL
ISEGLGHFAQDPSFIEATKAELADACDMTIEEMEQAASNILNGNTATNPTSSTSSTSQHS
PNGSLPCHNAAAAAATHRDRDAGMSPDDAGAEAGGGRGYIHGPSSIEERQELLARGGGRE
EEEEEANVREERPHRSSAVVAGARQKNSRLLEDEDLECVTSL
NT seq 6969 nt   +upstreamnt  +downstreamnt
atggtaaatgaaagcaaaaacatgtacatcccggaggacacccttgagaaccatcaaggc
tccgactactctccccctccccttcctcggcctcctccagttggcttgacgaacgagcac
agaggaggcggtaaccatggcgaccacagcggcgggggaggaggggtcaaccgtggggtg
ggtgtggttggccttgcaccggagcacattcccaccccgggagcagccctgagctggcaa
gcggccattgacgccgcgcggcaggcgaagatgatgggcaatgctgcgtcaggcggaggg
gcggggcttgggtcgggcgggggcggccccatttccacagccagctccacgcaaaggaag
agacaacactacgcttctaaacccaagaaacaaaccacaacgacagccacaaggccgccg
cgggccctgctttgtctcacactcaagaaccccatccgcagggcgtgcatcagcatcgtg
gagtggaaaccatttgagatcatcatcctgatgaccatctttgctaattgtgtggcctta
gccgtctacatccccttccctgaggatgactcgaatgccaccaactccaacctggagcgc
gtggagtacctgttccttatcatttttactgtggaggcgttcctcaaggtaatagcttac
ggcctgctcttccaccccaacgcctacctgaggaacggctggaatctgctcgacttcatc
attgtagtagtagggttattcagtgcgattttggagcaggccacaaagggagatggggcc
actccgattggagggaaggcggcaggcttcgatgtcaaggctctgcgggcattcagagta
ctaagaccgctcagactggtctctggagtacccagtttacaagtcgtgttgaactccata
atcaaagccatggttcctctgctccacatcgccctcctggttctcttcgtcatcatcatc
tacgccatcatcggcctggagctcttcatgggcaagatgcacaagacctgcatttacaac
cattcaggtacaaatgcagaggaaaaaccagcaccatgtgcacctgacggcgcttacggt
cggcactgcatgcagaacggaacgaagtgccaagtgggttgggaaggcccaaatgatgga
atcaccaactttgacaactttgcctttgccatgctgacagtgttccagtgcataaccatg
gaaggctggacggacgtgttgtactggatgcaggatgctatgggctatgagctgccatgg
gtctattttgtctctcttgtcatctttggctcatttttcgttctcaacctcgttctgggt
gtgttgagcggagagttttccaaggaaagagagaaggccaaagcacgtggcgacttccag
aaactacgagaaaaacagcaactggaggaggaccttaagggctatttagactggatcact
caggctgaagacatcgacccagagaatgaagaggagggcttggacgatgacaaacccaga
aacctgagcatgccagccagtgaaaatgaatcagtcaacacagataacgctcccggggga
gatgtggagggggagacctgctgcaccagactggcaattaggatctccaaatccaagttc
agtcgctactctcggaggtggaacaggttgtgtaggcgaaagtgtcgagcagcagtcaag
tcccaggttttctattggctggtcatcttcctggtttttctcaacaccctgaccatcgcc
tctgaacatcacaagcagcctcagtggctaacagacgtgcaagatatagcaaataaagta
ttactagcgctcttcactggtgagatgctcctaaagatgtacagtcttggtctacaggcg
tacttcgtgtcgctcttcaacaggttcgacagcttcgttgtgtgtggaggaatactagag
accattctagttgaaacaaagatcatgtctcctcttggcatctcagtgttacgttgcgta
cgcctgttgagaatatttaaaataacaagatactggaactctctctccaacctcgtggcc
tccctactcaactccgttcgttccattgcctccctgctgctcctgctcttcctcttcatt
atcatcttctccctgctgggcatgcagctctttggggggaaattcaactttgacgacacc
agacggagcacctttgacaactttccccagtctctgctcactgtgttccagattctaaca
ggagaagactggaactctgttatgtatgacggcatcatggcgtacggaggcccgtctttt
cctggcatgctggtctgcatctactttatcatcctcttcatctgcggaaactacatccta
ctgaatgtcttcttggccatcgctgtcgacaatctagcagatgctgagagtctgacatcg
gctcagaaagaagaggaggaggcgaaggagaggaaaaaactggccaggcttgccagtcca
gagaagcgtcaggataacgagaagcccccgatagaggaaaagaagtgtgagaagattgag
ctgaagtccatcacttctgatggagaaaccaacactgcaactaagatcaacatggatgac
tgctgtggagatgaaaatgaagagaagaacccatatcctgtgaatgattacataggagat
gaggatgaggaggagccagagatgccagtgggcccgaggccgcggccgctctctgacatt
cagctgaaagagaaggccgttcccatgcccgaggcccgcgccttcttcatcttcagccac
accaacaaattcagggttctgtgccacaagattgtcaaccacaacatcttcaccaatctc
atcctattcttcatcctgctcagcagcatcagtctggcggcagaggatccagtcaagaac
gactctttcagaaatcagatcttgggctatgcagatcacgtcttcactggactcttcacc
attgagatcattcttaagatgacagcctatggagccttcctccataaaggttcattctgt
agaaattatttcaacattctggacttagtagtggtcagcgtttctctcatctcttctgga
atacaactagacttctcgacgtccagtgcaattaatgttgtaaagatcctgagagtcctg
cgagtgctgagaccgctgagagccatcaacagagccaaaggactaaagcatgtcgtgcag
tgtgtttttgtggccatcagaaccatcggcaacatcgtcatcgtcactacattgctccag
tttatgtttgcctgtattggagtgcaactattcaagggaaagttcttctactgtagtgac
agctccaaacagactcaggcagagtgcagaggttcctacatcatgtataaggatggggat
gtggggaaaccaggaaaagcccagcgaatctgggaaaacagcgacttcaactttgatgat
gtcctgcagggaatgatggctttgtttgccgtgtctacgtttgagggctggcccgggttg
ctctaccgagccatagactctcacgctgaagatgtcggtccaatctacaactaccgcgtg
gtcatttcgatcttcttcatcatctacatcattatcatcgcctttttcatgatgaacatt
ttcgtcggtttcgtcatcgtcacatttcaggagcaaggagagcaggagtataagaactgt
gagctggacaagaaccagcgtcagtgtgtggagtacgccctgaaggctcgccctctgcgt
cgctacatccccaagaacccttaccagtacaaggtgtggtatgtggtcaactctacctac
ttcgagtacctgatgttcactctcatcctcctcaacaccatctgtctggccatgcagcac
catggacagaccaaaaatttcaatgatgcaatgaacatcctcaacatgctcttcacagga
ctgttcacagtagagatgatcctaaaattaatcgccttcaagcccagggggtactttagt
gatccctggaatgtgtttgatttcctcatcgtaattggcagcataatagacgtcattctc
agtgagatcaaccattattttgttgatgcatggaacacatttgatgccttgatagttgtg
ggtagcattgttgacatagcgatcactgaggttaacccagctgactcgtcctcgtcctcc
tcctcctcctcttcgtcctcctcttcctcttcttcctcctctcacccccatgtggtaagg
ccaatgggacttcagaattctgaagagaacgccaggatctccatcaccttcttccggctg
ttccgcgtgatgaggctggtgaagctgctatctcgcggggaagggattcggaccctgctg
tggaccttcatcaaatctttccaagctctgccttatgtagctctgctaatagtgatgctc
ttcttcatatacgccgtcatcggtatgcagatgtttggtaagatagcgctgcgggacaac
acgcaaatcaacaggaacaacaatttccagacattccctcaggcagtgctgctgctcttc
agatgtgcaactggtgaggcgtggcaagaaattatgctggcgtgttctcccaaacaccca
tgcgagaaagggtcgaccaatgaaaacagcacaacccatgacgattgtggcagccagttt
gccatcatttactttgtcagcttctacatgctgtgtgcctttctgatcatcaaccttttt
gtggccgtaataatggacaactttgactatctgacacgtgactggtcaattttggggcct
catcatcttgatgagtttaagagaatctgggccgaatacgacccagaggctaaggggagg
ataaaacaccttgacgtggtcaccttgctccggagaattcagcctcccctcggttttgga
aagctctgtccacaccgggtggcatgcaagcgcctggtatcgatgaatatgcctctgaac
agcgatggaacggttatgttcaatgccacactgtttgctttggtcagaactgcactcagg
atcaagacagaaggtaatctggagcaggctaatgaggagctaagagcaattgtgaaaaag
atctggaagagaactagcatgaagctgttggatcaagtagtgccccctgctggtgatgat
gaagtaacagttggaaagttctacgccaccttcctcattcaagaatatttccgcaagttt
aagaagagaaaagaacaaggcctggtggccaaggtgcctccaaaaactgccctttctctg
caggcgggcctgcggacgcttcatgacatcggtccagagatcagaagggccatctctgga
gacttgaacgtggaggaggagatagataaaggcatgaaggaatccgtgtcagctgcatct
gaggatgatatcttcagggtaaagcgaacaggtggcttgtttggaaaccacgtcaactac
tacaaccagagtgacggccgtgggtcctttccgcagtccttcaccactcaacgtcccttg
cacataagtcagaaaggctctccgtgcgaaggggaaagcccatcacatgagaagcttatg
gactcgaccatgttcaccccttcgtcatactcctcatcaggttcaaacgccaacatcaac
aacgccaataacactggaatgactggagtgacgacccagggcgtcagtcgattcccaagt
ccgtccataagcacggtggatgggcacacaggccagcccctcacacccatcctactacct
agatcagcatggtgtttccctccaaaaaggatgttttatgacaccctcatgcgctcggac
tcgagtgacagtcgtctgccaatcatccagagaggggaggggtcaacagaggagacgtac
gatgagagttatggtgacgacagggtgtacgaggacgatgagcactcactttcttctgac
atgttggtgtatcatgatgaaacatgtaaacagctcactcctatggaggaagcagaagaa
gtagaggagaaaaaaggaggaggaggttggcagtctccacgaagagtcttcttctgtcca
actaccctggcacggagatcttccttccatctggagtgtctccggaggcagacaaggcca
gatgtctcgcagaagactgctgtacctttacatcttgcacatcaccaggctcttgcagtg
gcaggtttgagtccccttttgagaaggagtcactcacctaccctcttcagccgactgtgt
tccacgcctgcagctaaccccacagaccaatgcagtgatgcctcctaccagcgagttcct
tctctaagactagagggctccaactctcatgaaaagctcaataccagcctgccttctgta
aattgtgggccctggtacaacgacagtaatgggaatagcccagtggacagtcctagccct
acgccggcgtccagtcaaagggcaccccggccagtgtcactcactgtaccatcgcttttg
gggaaggaccccagctcgctgtctcatggcagtgcaggcagtctagtggaagcggttctt
atatcagaaggtttgggtcattttgcccaggacccttctttcattgaggcaaccaaagcc
gagttagctgatgcctgtgacatgaccattgaggagatggagcaggcagccagcaacatt
ctcaacggcaacaccgccacaaaccccacatcaagcacctcttccacctctcagcacagc
cctaacggcagcctcccctgccacaatgcagcggcagcagctgcaacgcacagggaccga
gacgccggcatgagtcccgacgatgcgggggcagaggctggagggggcaggggctacatc
cacggtccatcctctatagaggagcgacaggaactgctagctagagggggagggcgagaa
gaggaggaggaagaggcaaatgtgagggaagagaggccccacagaagttcagctgtggtc
gcaggagcacggcagaagaacagcaggcttttggaggatgaggatttggagtgtgtgacg
agcttgtag

DBGET integrated database retrieval system