KEGG   Xiphophorus maculatus (southern platyfish): 102231514
Entry
102231514         CDS       T02923                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04060  Cytokine-cytokine receptor interaction
xma04068  FoxO signaling pathway
xma04144  Endocytosis
xma04218  Cellular senescence
xma04350  TGF-beta signaling pathway
xma04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102231514
   04350 TGF-beta signaling pathway
    102231514
   04068 FoxO signaling pathway
    102231514
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102231514
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102231514
  09143 Cell growth and death
   04218 Cellular senescence
    102231514
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102231514
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102231514
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102231514
Protein kinases [BR:xma01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102231514
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 102231514
NCBI-ProteinID: XP_005803552
Ensembl: ENSXMAG00000002747
UniProt: A0A3B5QGZ1
LinkDB
Position
3
AA seq 598 aa
MNGFRSCLSNMHGPQCCSSSRGVSLPSSLVLWAVFFLPLLKPGTAGIPGMSMYPISRLCK
FCDRQSSSCNGTESCMSHCSITSVCDSREEVCVAIWIKNETSFTVETLCHNPSVLLYGIM
LDDYNSSSCVMKEKNSTSGMVHVCSCTEEECNDKMVFVPKAKDQAVGDSLISIILVSLLP
LIVMGVLVAAVIHWYCVNRRRHLSKKWESNVKMRKPKAGGLDCRDACAFMADDDGSDSSS
IHANNLNHNTEPLPIELDLLVGKGRFAQVYKAKLKQSSSAQFETVAVKIFPSEEYASWKN
EKDIFSNKDLRHENVLHFLTAEERKAEKQYWLITAFHPCGNLQEYLTRHVISWEELQALS
SSLARGVAHLHSDRLTSGRPKVPIVHRDLKSSNVLVKKDLTCCICDFGLALCLDSSLSVD
DLANSGQVGTARYMAPEVLEARLDLENIESFKQTDIYSMALVLWEMTSRCKTIGEVKDYE
PAFGSKVRQHPYVESMKDNDRPDIPDSWLRHQGILAICTTIKECWDHDPEARLTAHCVAE
RLSEIEEELDKLSSRSSSAEKIRYEVHIPVAMEIPEEEVKISEIQNIIAADCSVSDKK
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgaacggtttcagaagctgcctcagtaacatgcacggaccgcagtgctgctcatcgtca
cggggagtttcgttaccatcatcattagtattatgggctgttttctttttgccgctgctc
aaacctgggacagctggtataccaggcatgtccatgtaccccatcagtcggctgtgtaag
ttctgtgaccgacagagttcctcctgcaatggcacagagagctgcatgtcccactgctcc
attacgtctgtctgtgattcgcgtgaagaggtctgtgttgctatatggataaagaatgag
accagcttcaccgtggagaccctttgccacaacccgtccgtgttgctgtacggcatcatg
ctggacgactacaacagctccagctgtgtgatgaaggagaagaactccaccagcgggatg
gtgcacgtctgctcctgcacagaagaagagtgtaatgacaaaatggtgttcgttcccaaa
gcaaaagatcaagccgtgggcgattccctcatctctattattctggtgagcctgcttccc
cttattgtgatgggagtcttggttgccgcggtgatccactggtactgcgtcaatcggcgg
cgccatcttagcaaaaagtgggagagcaacgttaaaatgcgtaagcctaaagccggcggg
ttggactgcagagacgcctgcgccttcatggcggatgacgacggctctgacagcagctcc
attcacgccaacaacctgaatcacaacaccgaacccctgcctatagagctggatctgctg
gtgggtaagggccgcttcgctcaggtgtacaaggcaaagctgaagcagagcagctcagct
cagtttgaaaccgtggctgtgaagatcttcccctctgaggagtacgcatcctggaagaac
gagaaggacatcttttccaacaaggacctcagacacgagaacgttctccacttcctgaca
gctgaggagaggaaggcagagaaacagtactggctcatcacagctttccacccctgtggg
aacctccaggagtatctgacgcgccacgtgatcagctgggaggaactgcaggcgttgagc
agctctctggcccgcggagttgcccaccttcacagcgaccggctcacaagtggacggccc
aaggtgcccatagttcacagagacctaaagagctccaacgtgctggtgaagaaagacctg
acctgctgcatatgtgactttggcctggcgctctgtctggacagcagcctgtcagtggat
gatctcgccaacagcggccaggtgggtacggcgcgctacatggcccccgaggtcctggag
gcccggctcgatctggagaacatcgagtccttcaagcagaccgacatttactccatggct
ctggtcctgtgggaaatgacatcaagatgcaaaaccataggagaggtgaaggactatgag
ccagcgttcggctccaaggtgcgacagcacccctatgtggagagcatgaaggacaacgac
agacccgacatccccgacagctggctccggcatcagggcattttggctatctgcaccact
atcaaggaatgctgggaccacgacccggaggcccgtctcacggcccactgcgtggccgag
cgactctctgagatcgaggaggagctggacaagctgtcgagccgcagctcctcggctgag
aagatccgatacgaggtgcacatccccgtcgccatggagatcccagaggaggaggtgaag
atctctgaaatccagaacatcatagctgcggactgctctgtgagcgacaagaagtga

DBGET integrated database retrieval system