KEGG   Xiphophorus maculatus (southern platyfish): 102232831
Entry
102232831         CDS       T02923                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102232831 (tgfa)
   04012 ErbB signaling pathway
    102232831 (tgfa)
SSDB
Motif
Pfam: EGF Laminin_EGF hEGF
Other DBs
NCBI-GeneID: 102232831
NCBI-ProteinID: XP_014328557
Ensembl: ENSXMAG00000015497
UniProt: M4AM23
LinkDB
Position
20
AA seq 245 aa
MTRILWDAIFLISGSFFTFGAGPSDSAVIEANVSIDAIATSAPDAPSNNSLTTSGKGTST
ANFLTSRSSLFTEKTNSTVTDAAVSLNTSAAAFRTPTSSSSTTISSTTSTTRRPAATTSK
RPVKKFVAAAVRSHFDDCPDSHQHFCFHGTCRFLILEETPACVCHPGFVGMRCEHADLLA
VVATNHRKQAVATVLVLCVIGCVLIMVLCSFLHCWWREDCRRRSRAHLYLAEKHGATCYP
PESVV
NT seq 738 nt   +upstreamnt  +downstreamnt
atgactcggattttgtgggatgctatttttctcataagcggttccttctttacattcgga
gcaggtccaagcgattcagctgtgattgaagcgaatgtttccatcgacgccatcgccacc
tctgctccagatgcacccagtaataattctttgaccaccagtggcaaaggaacaagcaca
gctaactttcttacaagtagaagttctctttttacagagaaaacaaattcaacagtcaca
gatgctgcagttagtcttaatacctctgctgctgcttttcgcaccccaacaagcagctcc
tccacaaccatcagcagcacaacctcaacaaccagaagacctgctgcaacaaccagcaaa
cgtccagttaaaaagtttgtggctgcggcagttcggtctcatttcgatgactgtcctgac
tctcatcagcatttctgctttcatggcacctgccgcttcctgatcctggaggagacacct
gcatgtgtgtgtcatccaggctttgtcgggatgaggtgtgagcacgcagacctgctagct
gtagtagcaaccaaccacagaaagcaggctgtggccacagtgctcgtgctgtgcgtgatt
ggatgtgtcctcatcatggtgttgtgttcgttcttacactgctggtggagggaggactgt
cggaggcggagtcgagcgcatctctatctggcagaaaagcacggagcgacatgctatcca
ccagagagtgtggtttga

DBGET integrated database retrieval system