KEGG   Xiphophorus maculatus (southern platyfish): 102233074
Entry
102233074         CDS       T02923                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
xma04115  p53 signaling pathway
xma04218  Cellular senescence
xma04310  Wnt signaling pathway
xma04340  Hedgehog signaling pathway
xma04371  Apelin signaling pathway
xma04510  Focal adhesion
xma04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102233074 (ccnd1)
   04340 Hedgehog signaling pathway
    102233074 (ccnd1)
   04371 Apelin signaling pathway
    102233074 (ccnd1)
   04068 FoxO signaling pathway
    102233074 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102233074 (ccnd1)
   04115 p53 signaling pathway
    102233074 (ccnd1)
   04218 Cellular senescence
    102233074 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102233074 (ccnd1)
   04530 Tight junction
    102233074 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102233074
NCBI-ProteinID: XP_005802721
Ensembl: ENSXMAG00000001483
UniProt: M3ZGZ3
LinkDB
Position
4
AA seq 292 aa
MEEQLLCCEVDSIRRAHQDENLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLKIHPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSPNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHGGAAETKRMDEDADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactctatcaggagagcccaccaggacgag
aacctacttaatgaccgagtcctacagactatgctgaaggcagaggagaactacttaccg
tcccccaactacttcaagtgtgttcagaaagagattatacccaaaatgaggaaaatacta
gccacttggatgttggaggtctgcgaagagcagaagtgcgaggaggaggtttttccgctg
gcgatgaactatttggacagatttttatcagtggaggccaccaggaaaacaagactgcag
ctgctaggagcaacctgcatgtttctagcatccaagatgaaggagactgtccccctcact
gcagagaagctctgcatctacacggacaactcggtcctacccggggagctgctgcaaatg
gagctgctggttctcagcaagctcaagtgggatctggcttcagtcactcctcatgacttc
attgagcacttcctgtccaagttgaagattcacccctccacaaagcagatcctcaggaaa
cacgctcagaccttcgtggcgctctgcgcaacagatgtcaactttattgctagtcctcca
tcaatggtggcagcaggaagtgtggtggctgctgttcaaggtctctacctgaaaagccaa
gacgcctccctctcctcaccaaacctcaccaacttcctgtcacaggtcattcgcagtgac
ccggactgtctgcggtcgtgtcaggagcagatagagtcgctattggagtccagtctgcga
caggctcagcaacacggtggcgcagcagaaaccaaacgcatggacgaggacgccgacctg
tcctgcacgcccacagacgtgagagacgtcaacatctga

DBGET integrated database retrieval system