KEGG   Xiphophorus maculatus (southern platyfish): 102233507Help
Entry
102233507         CDS       T02923                                 

Definition
(RefSeq) glutamate decarboxylase 1-like isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00250  Alanine, aspartate and glutamate metabolism
xma00410  beta-Alanine metabolism
xma00430  Taurine and hypotaurine metabolism
xma00650  Butanoate metabolism
xma01100  Metabolic pathways
Module
xma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102233507
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102233507
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102233507
   00430 Taurine and hypotaurine metabolism
    102233507
Enzymes [BR:xma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102233507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 102233507
NCBI-ProteinID: XP_005804643
Ensembl: ENSXMAG00000011440
UniProt: M4AAN7
LinkDB All DBs
Position
6
AA seq 583 aa AA seqDB search
MATSEPRATGEEQDPNAANLRPPTGTYEYAWMHGCTRKLGMKICGFLQKNNSLEERGRLA
GQKNLLSCDNSDRDSRYRRTETDFSNLFARDLLPAKNGEEPTIQFLLEVVEILTNYIKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGIRTGHPRFFNQL
SSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPGGEGDGLFSPG
GAISNMYSVMMARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTDNVILL
STDERGRVIPADLEAKIIAAKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKIKNREGFQMVFDGVPQHTNVCFWYIPPSLRGMPDSNEWREKLHRVAPKIKAMMMESGT
TMVGYQPQGNKVNFFRMVVSNAAATQSDIDFLIDEIERMGQDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgtccgaacccagagccaccggggaggagcaggaccccaacgcggctaattta
cgacccccgactggaacctacgagtatgcgtggatgcacggatgcacacggaaactgggg
atgaagatttgcggcttcctgcagaagaacaacagcctggaagagagagggaggctcgcg
ggccagaagaacctgctctcgtgcgacaacagcgacagagactcgcgctaccgccgcaca
gagacagacttctccaacctgttcgcccgagaccttctgccagccaaaaatggagaggag
cccaccatacagtttttgctggaggttgttgaaatcctcacaaactacatcaagaaaacc
tttgaccgctccaccaaggtgctggatttccaccaccctcaccagctgctggagggcatg
gagggtttcaacctggagctgtctgaccagccggagtccctggagcagatcctggtggac
tgcagggatacgctgaaatacggcatccggacaggccacccacggttcttcaatcagtta
tcttctggtttggacatcatcggcctcgccggagagtggctcacttccacggcaaacacc
aacatgtttacctacgagattgctccagtgttcgtgttgatggagcagctgactctgaag
aagatgagagagatgattggctggccaggtggagaaggagacggcctcttttcaccaggg
ggcgctatctccaacatgtacagcgtgatgatggctcgctacaagtactttcctgaggtc
aagactaagggcatgtctgctgctccccgcctcgtccttttcacatctgaacacagccac
tactctataaagaaggccggagccgctcttggttttgggaccgacaacgtcatcctgctg
agtactgacgaaagagggagagtcatacctgcagacctagaggctaaaatcattgctgcg
aaacaaaagggttacgtgccattgtttgtgaatgccacagctggttccactgtctatgga
gcatttgatcccatcaacgaaattgctgacatctgtgagaagtacaacctgtggcttcat
gttgatggtgcctggggcggcggactgctgatgtctaggaagcatcgtcataaactaaat
ggagttgagagggccaactctgtcacttggaacccccacaagatgatgggtgtcccttta
cagtgttctgccatcctagtcagagagaagggaatcctcgcaggctgcaactccatgtgc
gccggttaccttttccaaccagacaaacagtacgacgtcacctacgatacaggcgacaag
gccatccagtgtggacggcacgttgacatctttaagttctggctcatgtggaaagccaag
ggcacaattggctttgagcagcacatcgacaaatgtttggacctgtctcagtacctgtac
aacaagatcaagaaccgggaaggatttcagatggtttttgatggcgtgcctcagcacaca
aacgtctgcttctggtacatcccacccagcctgagagggatgcccgacagcaatgagtgg
cgagaaaaactccacagggttgctccaaagatcaaggccatgatgatggagtcggggacc
acaatggtgggctaccaaccccagggcaataaagtcaactttttccgcatggttgtctcc
aatgctgctgccacccagtctgacatcgacttcctgattgatgagattgagaggatgggt
caagacctgtag

DBGET integrated database retrieval system