KEGG   Xiphophorus maculatus (southern platyfish): 102233509
Entry
102233509         CDS       T02923                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04210  Apoptosis
xma04620  Toll-like receptor signaling pathway
xma04621  NOD-like receptor signaling pathway
xma04622  RIG-I-like receptor signaling pathway
xma04623  Cytosolic DNA-sensing pathway
xma04625  C-type lectin receptor signaling pathway
xma04920  Adipocytokine signaling pathway
xma05132  Salmonella infection
xma05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102233509 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102233509 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102233509 (ikbkg)
   04621 NOD-like receptor signaling pathway
    102233509 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    102233509 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    102233509 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    102233509 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102233509 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102233509 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102233509 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xma01001]
    102233509 (ikbkg)
Protein kinases [BR:xma01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102233509 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 Metal_resist
Other DBs
NCBI-GeneID: 102233509
NCBI-ProteinID: XP_014326407
Ensembl: ENSXMAG00000004368
UniProt: M3ZQ85
LinkDB
Position
1
AA seq 583 aa
MVQPQPDGPMQWDMSGEDSGGTLRVPPELAGNEVVTRLLGDNQQLREALRRSNQALRQRC
EEMEGWQRRTREEREFLSCRFQEARALVERLAQENHSLQSMVNGPGSSSNRSYSSAQMEA
SPGLPARNGPLDEPKTLDQWERKRVEETEQQTQTTPLRSLPAEGANEFLQLLKSHKEKTE
EEMREMRRKNEELKRERDEGKEVLERQHRCIEHLRAKLFHTQMSSNEEAVQLRSEAQHTS
DCSSLAKLTEQLQATQGRYRELEEKLDYLQKSSAQRDRTEALLKQKDKDCAQLAKDCEAL
KAQATSLLGELNERQILLQKSDDERKMLEEKLVSKVKALQAAERELEQQRKQHHVANDKL
LLQVQSLESALKSERHVVTEEKKKLSQLQHAYTCLFRDYDSKLKSEGGDLSSKLEEAERA
LAIKQDLIDKLKEEVEQQKGSLETVPVLTAQAEIYKADFLAEREAREKLNQKKEELQEQF
TQALAEIERLKHELTARARLEQMKLKHMDDFPARQTHIPPQQVVGFPGAGFNTVPPNRNH
VLAPVIDPAAAGAADLPDLCCPKCNYLAPDMDTLQIHVMDCIQ
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggtgcagccacagccggacggccccatgcagtgggacatgtctggagaggacagcgga
gggacactcagggtcccaccagagctcgctggcaatgaagtggtgaccagactgttgggc
gacaaccagcagctccgagaggctctgcggaggagcaaccaggccctgcgtcagcgctgc
gaagagatggagggatggcagcggcggaccagggaggaacgggaattcctcagctgtcgt
ttccaggaggcccgggcgctggtggagaggctggcgcaggagaaccactctttgcagagc
atggtgaacggaccaggctcatcgtccaaccgcagctacagctcggcccaaatggaggcg
tcaccggggcttcctgcccggaacggcccgctggatgaaccaaagactctagaccaatgg
gagaggaaaagagttgaagaaacggagcagcagacacaaaccacaccactccgcagcctg
cctgcagagggtgcaaatgagttcctgcaactgctgaagagccacaaagaaaaaacagag
gaagagatgagagagatgagaaggaaaaatgaagagttaaagagggaacgggacgaggga
aaagaagtgttagagcgacagcatcgatgcattgaacacctgcgggctaaactgttccat
acacagatgagcagtaatgaggaagctgttcagcttcgctcagaggctcagcacacctct
gactgctctagtctggctaaactcacagagcagcttcaggccacacagggcaggtatcgg
gagctggaggagaaactagattacctgcagaagagctcagctcagcgggacagaacagaa
gctttgctcaaacaaaaggacaaggattgtgcccagttggccaaggactgtgaggctctg
aaagctcaggcgacgtcgctgttaggcgaactgaacgagaggcagatcctcctgcaaaag
agcgacgatgagcgcaaaatgttggaggagaagctggtcagcaaggtgaaggccctgcag
gcggcggagcgggagctggagcagcagaggaagcagcatcatgtggccaatgacaagctg
ctgctgcaggtgcagagcctggagagcgcgctgaagtcggagaggcacgtggtgacagag
gagaagaaaaagctgtcacagttgcagcacgcctacacgtgtctgttcagagactatgat
tccaaactgaagagtgagggaggagaccttagcagtaagctagaggaggcagagcgggca
ctggccatcaagcaggacctgattgataaactcaaggaggaggtggagcagcagaaaggc
tcgctggaaaccgtccctgtcctcacagcacaggctgagatctacaaggcagatttcctg
gcagagcgagaagcgagagagaagctgaaccagaagaaagaggagctgcaggaacagttc
actcaggctctggctgagatcgaacggttgaagcacgagctcacagcacgtgcacgtttg
gaacaaatgaagctgaaacacatggatgattttcctgcacggcaaactcacattccccct
cagcaagttgttgggtttcctggtgctggcttcaacaccgtgccaccgaaccggaaccac
gttttggcaccggtcatcgatcctgctgcagcaggagctgcagatctgcctgatttatgc
tgtccaaagtgcaactacctggctccagatatggacacactgcagatacatgtcatggac
tgtatacagtaa

DBGET integrated database retrieval system