KEGG   Xiphophorus maculatus (southern platyfish): 102233516Help
Entry
102233516         CDS       T02923                                 

Gene name
gys1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00500  Starch and sucrose metabolism
xma01100  Metabolic pathways
xma04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102233516 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102233516 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xma01003]
    102233516 (gys1)
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102233516 (gys1)
Glycosyltransferases [BR:xma01003]
 Polysaccharide
  Storage polysaccharide
   102233516 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 102233516
NCBI-ProteinID: XP_014327242
Ensembl: ENSXMAG00000011787
UniProt: M4ABI5
LinkDB All DBs
Position
16
AA seq 709 aa AA seqDB search
MPLARSLSVTSLSGLDEWDEEFELEDAVLFEIAWEVANKVGGIYTVIQTKARMTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNASGCKVYFGRWLIEGSPYVVLIDVG
FTAWSLDRWKSELWDLCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQSEDPPHIVAQFH
EWLAGLGLVLCRQRQLAVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYH
RYCLERAAAHCAHVFTTVSQITAIEAEFLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KSRIQEFVRGHFYGNLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVITFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKML
DKEDFTIMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYIAARHMALAKAFPDTYVYDPQEPSSASGFRYPRPASVPPSPALSRHSSPHHSEGE
DNEEDERYDEELEAEKDRVNIRQPYTISVKGKTVLGGNGSGEDEASEKN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctgtctgtcacgtccctatcaggacttgacgagtgggacgag
gagtttgagttggaggatgctgtactttttgaaattgcttgggaggtagccaacaaagtt
ggagggatctacacagtcatacagaccaaagcccgtatgaccgcagaggaatggggggag
aactatttcctggtgggtccctacgtggagagcaacgtgcgcacccaagtggagctgatc
gagccaaccaatcctgtgctgaagcggaccattgataaaatgaacgccagtggctgtaag
gtttattttggccggtggcttattgaaggcagtccatacgtagttctgattgatgtcggc
ttcaccgcctggtctctggaccgctggaagagcgagctgtgggacctctgtgccatcggc
gtgccttggttcgaccgtgaggccaacgatgccgttctgtttggcttcctcaccgcttgg
ctcttgggagagtatgcggctcagtctgaggatcctccacacattgtagcccagttccat
gagtggctggcaggtctgggcctggtgctgtgcagacagagacagcttgctgttgcaact
attttcaccacccatgctacactgctgggtcgctacctgtgtgccggaaatgtggacttc
tacaacaacctggcagagttcaatgtggataaagaagccggagatcggcaaatttaccat
cgctactgtctggagcgggcagctgcacactgcgctcacgtcttcaccactgtgtcacaa
attacagccatcgaggccgagttcctgctcaagaggaaacccgacatcgtcactccaaat
ggtctcaatgtgaagaagttctctgctatgcatgagtttcaaaacctccacgctcagagc
aagagtcgcattcaggagtttgtcaggggtcacttctatgggaaccttgacttcaacctg
gacaagtgtctgttcctcttcatagcaggaaggtatgaattctccaacaaaggagccgac
atcttcctcgaggctttagccagactcaactatctgctgagagttaaccacagcgatgtg
accgttataactttcttcatcatgccagctcggaccaacaacttcaacgtggagacgctg
aagggccaagcagtgcggaagcagctatgggatacagcccagactgtaaaggagcgcttt
ggaaagaaactttatgaatcactcctagttggtcagctgccagatgtgtcgaagatgctg
gacaaagaagacttcaccatcatgaagcgtgctatctttgcgactcagaggcagtgccag
cctccagtctgcacccataacatgctggaggacagcagcgaccccatccttaactgcgtc
cgccgcatcggcctcttcaacagctctgctgaccgagtcaagatcatcttccacccagag
ttcctttcatccacgtctcctctgcttcccatggattacgaggagtttgtcagaggctgc
caccttggtgtcttcccttcttactatgagccttggggttatacaccagctgagtgcaca
gtgatgggtattccatccatatccactaatctgtcaggcttcggatgtttcatggaggaa
cacatagcagatccttcagcgtacggtatttacatccttgaccggcgctacaagggtgtc
gacgagtcgtgcaaccagctcacttccttccttttccagttctgcaaacagagccgacgc
cagcggatcatccagaggaatcgcacagagcgcctgagtgacctcctggactggagatac
ctcggcagatattacatagctgctcgtcatatggccttggctaaagccttcccagacacc
tacgtatatgaccctcaagagccctcctcggcttcgggtttccgctaccctcgaccagcc
tctgtgcctccgtctccggctctgtcccgtcactcctccccgcaccacagcgagggcgaa
gacaacgaagaggatgagcgttacgacgaggagcttgaggccgaaaaggaccgcgtgaac
atccgccagccctacaccatatcggttaaaggcaaaaccgtcctcggaggcaacgggagc
ggcgaggacgaggcgagcgagaaaaactga

DBGET integrated database retrieval system