KEGG   Xiphophorus maculatus (southern platyfish): 102234160Help
Entry
102234160         CDS       T02923                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma03030  DNA replication
xma03410  Base excision repair
xma03420  Nucleotide excision repair
xma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:xma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    102234160 (lig1)
   03410 Base excision repair
    102234160 (lig1)
   03420 Nucleotide excision repair
    102234160 (lig1)
   03430 Mismatch repair
    102234160 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xma03032]
    102234160 (lig1)
   03400 DNA repair and recombination proteins [BR:xma03400]
    102234160 (lig1)
Enzymes [BR:xma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102234160 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     102234160 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     102234160 (lig1)
DNA replication proteins [BR:xma03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    102234160 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     102234160 (lig1)
DNA repair and recombination proteins [BR:xma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     102234160 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     102234160 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     102234160 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 102234160
NCBI-ProteinID: XP_014330351
Ensembl: ENSXMAG00000005804
LinkDB All DBs
Position
6
AA seq 1007 aa AA seqDB search
MQRSIASFFQPRSKAKDSQKKTADEPLKKPIKSPLKVQNGVQEADSPIKKVAKRSRQIVD
SDEDEVPLVKEQGDKGAPAKTEKTDDVFKAILTPLSPTPAPSIPVTLETPETSASSTSAS
STSSGTPSTPSSTSTSRIVKRKTARKMFPKRKLDESESRKGEFEVAEEQGQQNKRPRLES
SVSSAENTDEPMEEGAKEEKVEKPVAEANSPDEEVGNEKTEGEKAKKEEEQVEEKISDEK
EKKAEGAEKKNEAKKKTDDEQGPSVAKDKVVEKDTKDTGSPKSQMEEKKQKEAKEQKDKE
PAKKTPISSFFAPRKAAVKTEKPEKNEGEKKTSAERKSSEEEEKDAKGESTSGETNYDPS
RPNYHPVDHACWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLLRSVLLLSPDDLLC
CVYLCLNQLGPAYLGMELGVGETVLMKAVAQATGRHLDKIKTEAQEKGDLGLVAESSRSN
QRTMFQPASLTAGGVFKKLKEIASMSGNSAMNKKIDIIKSLFVACRFSEARYIVRSLAGK
LRIGLAEQSVLSALSQAVCLTPPGQGFPPAVIDAGKGMSAESRRAWIEEKSLILKQTYCE
MPNYDVIVPVLLKAGIDQLPKHCKLTPGVPLRPMLAHPTKGVGEVMKRFDEAAFTCEYKY
DGERAQIHILESGEVRIFSRNQEDNTSKYPDIISRVPKVKKDSVVSCVLDTEAVAWDREK
KQIQPFQVLTTRKRKDVDASEIKVQVCVYAFDLLYLNGESLVRQPLCRRRELLRESFTEV
EGEFLFARSIDSHDTDAIAEFLEQSVRDSCEGLMVKTLEKDATYEIAKRSHNWLKLKKDY
LDGVGDTVDLCVIGAYLGKGKRTGTYGGFLLACYDEDNEEFQSVCKIGTGFKDEDLEQHY
KFLKEHTLAKPRPYYRVEQSAEPDVWLDAVQVWEVKCADLSLSPVYKAAMGMVDAEKGIS
LRFPRFLRIRDDKKPEDATTGAQIADLYKKQQQIQNQGEKADPEDYY
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagcatcgcatcgttttttcagcccaggagcaaggctaaagacagccagaag
aaaactgcagatgaaccattgaaaaagcccataaagagccccttgaaggtgcagaacggc
gtccaggaagcggattcgccgatcaagaaggtcgccaagcgcagccggcaaatcgtggac
agcgacgaagacgaggtgccgcttgtaaaagaacaaggcgacaaaggagctcccgctaaa
accgagaagacggatgatgtgttcaaagccatactcaccccgttgtctccaacgccggcc
ccatccatacccgtaaccctggaaaccccggagacgtcggcctcctcaacgtcggcctcc
tcaacgtcttcagggacgcccagtactcccagttccacctccacgtctagaattgtgaaa
cgcaaaactgcgaggaagatgttccccaagaggaagctggatgagagcgagagtcggaaa
ggggagttcgaggtcgcggaggagcagggtcagcaaaacaaacgaccccgcttggagagc
agtgtcagcagtgcagagaacaccgatgaacccatggaggagggagcaaaggaagaaaag
gttgaaaagccagtggctgaggctaacagcccagacgaggaggtggggaacgagaaaaca
gaaggagagaaggccaagaaggaggaggagcaggtagaagaaaagatctctgatgagaaa
gaaaagaaagctgagggggcagaaaagaaaaatgaagcaaagaagaagacggatgatgag
caagggccttctgtcgccaaagacaaggtggttgaaaaggacacgaaagacacagggagc
ccaaaaagtcaaatggaagaaaaaaagcagaaagaggcgaaggagcagaaagataaggag
ccagccaagaaaaccccaatcagcagtttctttgctcccaggaaagcagcagttaagaca
gagaaaccagagaagaacgaaggagagaaaaagacgagtgctgagaggaagagctccgag
gaggaagagaaagacgcaaaaggtgaatcaacctcaggagagacgaactacgatccttcc
agaccaaactaccatccggtggaccacgcctgctggaaacaaggccaaaaagtgccgtac
ttggcagtggctcgcacctttgagaaaattgaagaggactctggcaggctgagaaacatc
gagacgctgtcgaacctgctccgctcggtgctgctgctctctccagacgacctgctgtgc
tgtgtgtacttgtgtctgaaccagctcggccccgcctaccttgggatggagctcggcgtc
ggggagacggtgctgatgaaagccgtcgctcaagcaaccgggcgacatttggacaaaatt
aaaacggaggcgcaggagaaaggagatttgggcctcgtggccgagagttcccgtagcaac
cagcgcaccatgttccagccggccagtctgacagcaggaggcgtgtttaagaaattgaag
gaaattgccagcatgagtgggaactcggccatgaataagaaaatcgacatcatcaaaagc
ctctttgtggcgtgccgcttctccgaagcccgctacatagtcaggtccctggctgggaaa
ctgaggattggcctcgctgagcagagtgtcctctccgccctgagccaggccgtctgcttg
accccgcctggacaaggtttccctcctgctgtgattgatgcagggaagggcatgagcgct
gagagcaggcgggcctggatcgaagagaagagcctcattctgaaacaaacatactgcgaa
atgccaaattatgacgtcatcgtcccagttttactgaaagcaggcatcgaccagctgcct
aaacactgcaaactcactccaggagtcccgctgaggcccatgttggctcaccccaccaag
ggtgtcggcgaggtgatgaagaggtttgacgaggcagcgttcacctgcgagtacaaatat
gacggagagcgtgcacagattcacattctggaaagcggtgaagttcggattttcagccgc
aaccaggaagacaacaccagcaaatacccagatatcatctcgcgtgtccccaaggtaaag
aaggactctgtagtgtcttgtgttctggacacggaggcggtggcctgggatcgagagaag
aaacagatccaacccttccaagtcctcaccactcgtaagagaaaggatgtggacgcctca
gagatcaaagtccaagtgtgtgtgtacgcctttgacctcctctatctcaacggagagtcc
ctggtgcgacagccgctgtgtcggcgtcgggagctgctgagagagagcttcacagaggtg
gagggagagtttctgttcgcccgttccatcgattctcacgacactgacgccatcgcggag
ttcctggagcagtccgtccgagactcctgcgagggcctgatggtgaagactctggagaag
gacgcgacctatgagattgccaagcgttctcacaattggctcaagttaaagaaggactac
ctggacggtgtgggcgacacagtggacctctgcgtgatcggtgcctaccttggaaaggga
aaaagaacaggcacatacggtggcttcctgctggcctgctatgatgaagacaatgaggag
tttcagtcagtctgcaagatcgggacaggctttaaggatgaagatctggagcagcattac
aagtttttaaaggagcacaccctggccaagccccgcccatactaccgcgtggaacaatca
gccgagcccgacgtgtggctggacgccgtgcaggtttgggaggtgaagtgcgccgacctc
tcgctgtcgcccgtctacaaggctgccatgggaatggtggatgcagagaaaggcatttct
ctgcggttccctcgtttccttcgcatcagagacgacaagaagcccgaggacgccaccacc
ggagctcagatcgctgatttgtacaagaagcagcaacagattcagaatcaaggggagaaa
gctgacccggaggactactactga

DBGET integrated database retrieval system