KEGG   Xiphophorus maculatus (southern platyfish): 102235401
Entry
102235401         CDS       T02923                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102235401
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102235401
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xma04030]
    102235401
G protein-coupled receptors [BR:xma04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102235401
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 102235401
NCBI-ProteinID: XP_005801561
Ensembl: ENSXMAG00000013421
UniProt: M4AG59
LinkDB
Position
16
AA seq 367 aa
MDIDNNTSNGCYSNQNVTFFYQQVNKTIRGNWTTRDHLVIGLGLPLSLIVVLANLLVMAA
IHMNRRFHFPIYYLLGNMAAADLFAGLAYTNLIFNTGPWTAKLSKKQWYIRGALIDISLT
ASVANLLAVAVERHQTIITMQLHSTMTKRRVVLLIISIWAVGIIMGLVPSLFWNCECDLA
DCSTVAPLYSRRFLIFWALLNLLTFFIMLGMYSHIFFHVKRQSRHTSQHASEARQQTVIN
LMKTISMVLGAFVICWTPGLIVLLLDGLQGKESNANKYEKYCLAIAECNSLVNPIIYSLR
DAEMRKTFKWILCCFCRREGCQPRETLSTEIDSPLKEKILSYKLEDPVLWKNPDRDSKDD
KWTDSVV
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggacattgacaataatacgtcgaacggctgctacagcaaccaaaacgtcaccttcttt
taccaacaggtgaataaaacgatcagagggaactggactacacgggaccacctggtcata
ggactaggcttgcccttatccttaatagtggtgttggccaacctgttagtgatggcagcc
atccacatgaaccgccgctttcacttccccatttactacctgctgggaaacatggcagca
gcagacttgtttgcaggtttagcctataccaacctgatattcaacacgggaccctggaca
gcgaagctctctaagaagcagtggtacatccgtggggctttgattgacatcagcctgact
gcctccgtcgccaacctcctggctgtggctgtggaacgccaccagaccatcatcactatg
cagctgcacagcaccatgaccaagaggcgcgtggtgctgctcatcatctccatctgggcc
gtagggatcatcatgggtctggtgccatcgctgttttggaactgtgaatgtgatctcgca
gactgctccactgttgctcccctctacagccgccgcttcttgattttctgggcacttctc
aacctgctcacctttttcattatgctgggcatgtactctcacatattctttcacgtgaaa
cgccagagtcgccacacttctcagcacgcctccgaggcacgacagcagacagtcatcaac
ttgatgaaaaccatttctatggttctgggtgcctttgtgatctgctggacacctggcctc
atcgttctcctcctggacgggctgcagggtaaagagagcaacgccaacaaatatgagaaa
tactgtttggcgatagcggagtgcaactctctggtcaatccgatcatttattccttacgt
gacgccgagatgcggaaaacgttcaagtggatcctttgctgtttttgtcgacgtgagggc
tgtcagccgagggagactctgtcaacagaaattgactctccattgaaggagaaaattcta
agctacaagttagaagatccggtcttgtggaagaatccggacagagacagtaaagatgac
aagtggacagactctgtggtatga

DBGET integrated database retrieval system