KEGG   Xiphophorus maculatus (southern platyfish): 102235474Help
Entry
102235474         CDS       T02923                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00020  Citrate cycle (TCA cycle)
xma00190  Oxidative phosphorylation
xma01100  Metabolic pathways
xma01200  Carbon metabolism
Module
xma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xma_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102235474 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102235474 (sdha)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102235474 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 102235474
NCBI-ProteinID: XP_005799067
Ensembl: ENSXMAG00000008900
UniProt: M4A3A0
LinkDB All DBs
Position
3
AA seq 663 aa AA seqDB search
MATVRAASRLLSKRVLSNTKAVPAAAVQGSRNFHFSIYGKKKSAKVADDISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEQDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECKGVIALCMED
GSIHRFRAQNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPDK
DHVHLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQA
IDHTNGEDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEEHKPGEKL
SPLKPSAGEESVANLDKLRFANGSLRTSEIRLNMQKTMQNHAAVFRTGSVLKEGCDKMAD
VYQSMEKIKTFDRGIVWNTDLVESLELQNLMLNGVQTINAAEQRKESRGAHAREDFKDRI
DEYDYSKPLQGQQKKPFEQHWRKHTMSYVDPKTGKVTLRYRPVIDSSLNEQDCAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtacgcgcggcgtcccgtctcctctccaagagggtgctctctaacacgaaa
gcggtccctgctgctgcagttcagggttccaggaactttcacttctccatctacggcaag
aagaaaagcgccaaagtagcagatgatatctccactcagtatcctgttgtggatcacgag
tttgatgccgtggtggtgggagccggaggagctggccttcgggccgcttttggcctatca
gaggccggcttcaacaccgcctgcgtcaccaagctcttccccaccaggtctcacaccgtc
gctgcacagggtgggatcaacgcggctctgggtaacatggagcaggatgactggcgctgg
catttctacgacacggtgaagggatctgattggctgggagaccaggacgccatccattac
atgacagagcaggctcctgcagccgtagtggagctggaaaactttggcatgccgttcagc
cgcaccgaagacgggaagatctaccagagagccttcgggggtcagagtctcaagtacggt
aaggggggccaggcccaccgctgctgctgtgtggcggaccggacgggacactccctgctg
catacgctttatggaaggtcgctccgctatgacaccagctactttgtggagtactttgcc
ctggatctgctgatggaaaacggagagtgtaaaggagttattgctctctgcatggaggac
ggctccatccaccgcttcagagcccagaacaccgtcatcgccaccggtggttacggaagg
acgtatttcagctgcacgtctgcccacacaagcacaggagacggaaacgccatggtgacc
agagccggcctgccgtgccaggatttggagtttgtgcagttccatcccactgggatctac
ggggctggctgcctgatcacggagggttgccgtggcgagggaggaatcctgatcaacagc
gagggcgagcgcttcatggagcgttacgcccccaacgccaaagacctggcttccagagac
gtggtgtcccgctccatgaccatagagatcagagagggcagaggtgtgggtccggacaag
gaccacgtgcacctgcagctccaccacttgcctccgcagcagctggccaccaggctgccc
gggatctccgagacggccatgatcttcgctggagtcgacgtgactaaagagcccatcccc
gtcctgcccacggttcactacaacatgggaggaattcccaccaactacaagggacaggcg
atcgatcacaccaacggcgaggacaaggtggttcctgggctgtacgcctgcggtgaggcg
gcttgtgccagcgtgcacggcgctaacaggctgggcgctaactccctgctggacctggtg
gtgttcgggagagcctgcgcgctgacgatcgcggaggagcacaaacctggagagaagcta
tccccgctgaagcccagcgcaggagaggagtctgtggccaacctggacaagctgaggttt
gctaatggaagtctgagaacatctgagatcaggctgaacatgcagaagaccatgcagaac
cacgccgccgtcttccgtaccggctctgttctgaaggagggatgcgataagatggccgac
gtctaccagagcatggagaagatcaaaacgtttgacagaggcatcgtgtggaacacagat
ttggtggagtcactggaactgcaaaacctgatgctgaacggcgtccaaaccatcaacgct
gctgagcaaagaaaggagagcaggggcgcccacgccagagaggacttcaaagatcgtatc
gatgagtacgactactccaagcccctgcagggccagcagaagaagcccttcgagcagcac
tggaggaagcacaccatgtcatacgtagaccccaaaactggaaaggtgacgctgaggtac
cgccccgtcatcgacagctctctgaacgaacaggactgcgcccacgttcctcctgccatc
cgctcgtactga

DBGET integrated database retrieval system