KEGG   Xiphophorus maculatus (southern platyfish): 102235712Help
Entry
102235712         CDS       T02923                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00062  Fatty acid elongation
xma01040  Biosynthesis of unsaturated fatty acids
xma01100  Metabolic pathways
xma01212  Fatty acid metabolism
Module
xma_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102235712
   01040 Biosynthesis of unsaturated fatty acids
    102235712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:xma01004]
    102235712
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     102235712
Lipid biosynthesis proteins [BR:xma01004]
 Elongase
  PUFA
   102235712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO Zip
Motif
Other DBs
NCBI-GeneID: 102235712
NCBI-ProteinID: XP_023195907
Ensembl: ENSXMAG00000013172
LinkDB All DBs
Position
9
AA seq 334 aa AA seqDB search
MLRQLQEMGSHALDIYNYLLAGIDPRIKDYPLMKSPVPMTAILLVYLFFILYVGPRIMAN
RKPFQLKEPMILYNFLLVALSVYIVYEFLMSGWATTYTWRCDPIDTSNSPQALRMVSVAW
LFWFSKIIELMDTIFFVLRKKHGQITFLHIFHHSFMPWTWWWGVVFAPGGMGSFHAMVNS
SVHVIMYFYYGLSAAGPRFQKFLWWKKYMTAIQLTQFVLVSLHATQYYFMDSCDYQFPTV
IHLVWMYGTFFFVLFSNFWVQAYVKGKRLPKQELKEQKNGAVAYANGKYQENGKVHENVK
YENGSSNGIHHHAATNGSTHYENSHAHNGKMKKA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggcaacttcaggagatgggctcgcatgccttggatatctacaattacctcttg
gcaggaatagatccacggataaaggactacccattgatgaagagtcctgttcccatgact
gcaatactattggtctacctgtttttcatactgtacgtgggacctcgcattatggccaac
cggaaacccttccagctgaaggagcccatgatactctacaatttcttgctggtggctcta
tcagtttacattgtgtatgagtttctgatgtctggttgggctacaacatatacttggaga
tgtgatcctattgatacctcaaatagtcctcaagctctaagaatggtcagtgttgcatgg
ctcttctggttttcaaagataattgagctgatggacacaatcttctttgtgttgaggaaa
aaacacggccagattacgttcctgcacatctttcaccactccttcatgccgtggacctgg
tggtggggagttgtctttgctcctggtggaatgggatctttccatgccatggtgaactct
tccgtccatgtcatcatgtatttctattatggcctttctgctgctggaccgcgcttccag
aagtttttgtggtggaagaaatacatgactgccattcagctgacccagtttgtcctggtc
tccctccacgccactcagtattactttatggacagctgtgactaccagttccccaccgtc
attcacctcgtctggatgtatggcaccttcttcttcgtcctcttctccaacttctgggtc
caggcctacgtgaagggtaagcggctgccgaaacaggagctcaaggaacagaagaatggt
gcagtggcatatgcaaatggcaaataccaagagaacggaaaagtccacgaaaatgtcaaa
tatgagaacggcagcagtaacggcatccaccaccacgcagctaccaacggctccactcac
tatgagaacagccatgcccacaacggcaagatgaagaaagcttag

DBGET integrated database retrieval system