KEGG   Xiphophorus maculatus (southern platyfish): 102235762Help
Entry
102235762         CDS       T02923                                 

Gene name
setdb1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102235762 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xma03036]
    102235762 (setdb1)
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102235762 (setdb1)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102235762 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102235762 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Tudor_4 DUF5604 TUDOR_5 Pre-SET MBD
Motif
Other DBs
NCBI-GeneID: 102235762
NCBI-ProteinID: XP_023187219
Ensembl: ENSXMAG00000016600
LinkDB All DBs
Position
3
AA seq 1254 aa AA seqDB search
MESCDGMEVDDWDPSLEDELGVSLDDLKKWIEEAVEQNEAVKKKKAQLIELEEWVEQKEK
EEAKTEKLLNDANQSVLECEKLVRAAYENNGLVYRESSSEDEGGGGGGGHPSEVIEIDDD
DDDDVIAVGCLVPPKTPSKDPTLNEASAVLQKTTQQVQKLVQIVAKPSSVSPLIRTAVQS
VVQPGVQGPTPAIFVSQAPSHQTMTQTQPNPNIKEDELKVGMNILGKKRTKTWHKGNLVA
INPVGNGIFKYKVRFDKGKSLLSGNHVAFDYNPTLESLYVGARVVAKYKDGNLVWLYAGI
VAEMPNNKNRMRFLIFFDDGYASYVILPELYPVCRPLKRTWEDIEDASCRDFIEEYISAY
PSRPMVLLKVGQIIKTEWEGTWWKSKVEEVDSSLVKILFLKDDKRSEWIYRGSTRLEPMF
NLKLASANTQEKKLAGHQRTRPNMGALRSKGPVVQYTGVEHVGASPAKPPQTTQSQPPAT
TLIQQLQQRPQPQLIQQVQPSLQTQQPQTQQTQQTPQPSPAAQLQRIENKHQMAKKSTSN
FIPGVGGTHASKILQAASANASNLLVGKVQSTPSTPTSSFTPLYQRQTSALVSPPSIVTH
AMATIPQQPSYRAPTDRIFYLAHTCQPACLNRVRPAKSDLHRGKNPLLTPLLYDFRRMTG
RRKVNRKMSFHVIYKAPCGLCLRNMGEIQYYLFQTRCDFIFLEMFCLDPYVLVDRPFQPQ
RPFYYIPDITSGKEDIPLSCVNEIDTTPPPNVKYSKERIPEDGVFINTSSDFLVGCECTD
GCKDKSKCSCHQLTLQASGCTPGGQINQSAGYSYKRLEECLPTGIYECNKRCKCCSQMCT
NRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEY
FANLDHIESVENFKEGYESEAHCSDSEGSGVDVSRMKIQPSALVSSSAARKKAQSSSSSD
DSNDEEEKDSKSEDESDSSDDTFVKDNYYTPSSVWRSYTTRGQAKGNKEGSQDSKDGLSV
SAKGQDDEKPPSMPEETGKSKVASWLTSQGLKKETGDKSQIKTEQSKKQDVMTLSDSDDV
QTISSGSEDNKEREKATPASVSGVTKKQVAVKSTRGIALKNSHSLMVKPPGGGVGPSAQG
SKPGHQGQPGGGAENAPKNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFV
DTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVEGKELLCCCGSTECRGRLL
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atggaaagctgtgatggaatggaggttgacgactgggaccccagtctggaggacgagttg
ggagtttcactggatgacctgaagaaatggattgaggaggctgtggagcagaacgaggct
gtgaagaagaaaaaagcccagttgatagagctcgaggaatgggtggaacagaaagagaaa
gaagaggcgaaaacagagaaacttctcaacgatgcaaaccagtccgtattggagtgtgag
aagctggtgagggcagcgtatgaaaacaacggcctcgtctaccgagagagcagctcagag
gatgaaggaggtggcggaggaggagggcacccctctgaagtcatcgagattgatgatgat
gacgacgatgacgtcatagctgtaggatgtttggttcctccaaagacgccatctaaggac
ccaacattaaatgaagcctctgcagttctgcagaaaaccacccagcaggtccagaagttg
gtccaaatagtcgccaagccttcctctgtttctccattgatacgaacagcagtgcaatct
gtagttcagccaggagttcagggcccgacaccagcaatatttgtatcacaagctccgtct
catcagacgatgacgcagacgcagccaaaccccaacataaaagaagacgagctcaaagtg
gggatgaacatcctgggaaagaaacgcaccaagacatggcataaaggcaacctggtggca
attaaccctgttggaaatggtatatttaagtacaaggtgaggtttgataaaggcaagagt
ctgctgtctggaaatcatgtggcgtttgactacaaccccaccctggagagcctgtacgtc
ggggctcgtgtcgtcgctaagtacaaagacggaaacttggtgtggctgtacgctggaatc
gtagcagagatgccgaacaacaagaaccgcatgaggtttctgatcttctttgacgacggc
tacgcttcatatgtgatccttcctgaactgtatccggtttgcagaccattaaaacgaact
tgggaagacatagaggatgcatcttgtcgggacttcatcgaggagtacatctccgcctat
cccagcaggccgatggtgctcctaaaggttggccagataatcaagacagagtgggagggg
acctggtggaagagcaaagtggaggaagtggacagcagcttggtcaaaatcctctttctg
aaggacgataagaggagcgaatggatttacagaggatccaccaggttggagcccatgttc
aatctgaaattggcttcagcaaacacacaagaaaagaagctagctggccaccagaggaca
aggccaaacatgggagcattaaggagtaaaggcccagtcgttcagtacactggcgtcgaa
cacgtcggagcttctcctgccaaaccccctcaaacgacacagagtcagccgccagcgacg
acactgatccagcagcttcagcagcgcccgcagccccagctcatccagcaggtccagcca
tccctgcaaacccagcagccacaaactcaacaaacccagcaaacccctcagccctcaccg
gctgcccagcttcaacgcattgaaaataaacatcagatggcaaagaagagcacgtctaat
ttcatccctggtgtcggcgggacgcatgcctccaagatcttgcaggctgcgtctgctaat
gccagcaacctcttagttggaaaagtgcagagcaccccgagtacacccacgtcctccttc
acacctctgtatcagagacagacgtccgccctggtgtctcctccttccatcgtcacgcat
gccatggccaccatccctcagcagccgtcctacagagccccgacggaccgcatcttctac
ctggctcacacctgtcagcctgcgtgtctgaaccgcgttcgaccagcaaaatcagacctg
cacagaggaaagaaccccctcctcactccgctgctctacgatttcagacgcatgacggga
cgacgcaaagtcaaccgtaaaatgtccttccatgttatctacaaggctccgtgtggactt
tgtctgcgtaacatgggggagatccagtactacctcttccagacccgctgtgactttata
ttcttagagatgttctgtctcgacccgtatgtcttggtggaccggcctttccagccacaa
aggcccttctattacattccagacatcactagtgggaaggaggacatccctctgtcctgc
gtcaatgagattgataccactccaccacctaatgtaaaatacagcaaggagcgaatccct
gaagacggagtatttattaacaccagttcagacttcctggtcggctgtgaatgtaccgac
ggctgtaaagacaaatccaaatgttcctgccaccagctgaccctgcaggcttcaggctgc
acacctgggggacagatcaaccagagcgctggatattcatacaaacgattagaggagtgc
ttacctacagggatctatgagtgcaacaaaaggtgtaaatgttgttctcagatgtgcacc
aaccggctggtgcagcacggcctgcaggtccgtctgcagctctttaagacacagaacaaa
ggctggggcattcgctgtctggatgatatagctaagggatcatttgtgtgcatttatgct
ggtaaaatcctgactgatgatttcgctgacaaagaaggtctagagatgggtgacgagtat
tttgctaacctggaccacatcgagagcgtggagaacttcaaggaaggctatgagagcgag
gcgcactgctccgacagcgagggcagcggcgtggacgtgtccagaatgaaaatccagccg
tccgctttagtctccagcagcgctgcgagaaaaaaagctcagagctccagctcttcagat
gacagcaatgacgaagaggagaaagattcgaagagtgaagatgaaagcgacagctcagac
gacacttttgtgaaggacaactactacacccctagctctgtgtggaggagttacacgact
cgtggtcaggccaagggcaacaaagaagggagtcaggacagtaaagatggactgagtgtc
tcagccaaaggtcaggatgatgagaagccgccctctatgccagaggagacggggaaaagc
aaagtggcttcctggttaacaagccagggtctgaagaaggaaactggagacaagagtcaa
ataaagacagagcaatcaaagaaacaggacgtcatgactctatcggacagcgacgatgtt
caaaccattagctccggatctgaagacaacaaagagagggagaaagccactccggcttct
gtatctggcgtgaccaagaagcaggtggcagtgaaatccacgcgaggcatcgccctgaag
aacagccacagtttgatggtgaaaccgcctgggggaggagtcgggcccagcgctcagggg
agcaaacccggccaccaggggcagcctggaggaggggcagaaaacgctcccaaaaacacc
cggctgttctttgacggcgaagagtcctgctacatcatcgatgccaagttggagggaaat
ctgggacgttacctcaatcacagctgcagtcctaacctgttcgtccagaacgtgtttgtc
gacacacacgacttgagattcccctgggtggcgttcttcgccagcaagcggattcgggcc
gggacagaactgacctgggattataactacgaggtgggaagcgttgaaggcaaagagctg
ctgtgctgctgcggatccacagagtgccgtggacggctgctgtga

DBGET integrated database retrieval system