KEGG   Xiphophorus maculatus (southern platyfish): 102235773
Entry
102235773         CDS       T02923                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04012  ErbB signaling pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102235773
   04068 FoxO signaling pathway
    102235773
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102235773
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102235773
NCBI-ProteinID: XP_014330035
Ensembl: ENSXMAG00000009648
UniProt: M4A5C1
LinkDB
Position
2
AA seq 194 aa
MKTGRSWLLEDSAVLGGKMSDVRLSNGSPTLERTEPRVTEHPKPPACRSLFGSVDHEELK
RDFKGHMRELQEAASAKWGFDFASDKPLPNARFTWELVDPAQVPDFYARPPRREKGVCPG
NNNVDLNGNHSCDSSMSDVLTECTEQCTGLRKRPCHDTTAQSKRSRSSPDEVSCPALSHS
VEHTPRKSSPRRQT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaaaaccggacgctcctggcttctggaagattcagctgttttggggggtaaaatgtct
gacgttcgactttcaaacggaagcccgacgttggaacggacggagccccgggttacggaa
cacccgaagccgccagcctgccgaagcctcttcggctcggtggaccacgaagagttgaag
agggattttaagggacatatgcgggagctgcaggaggctgcgtccgccaagtggggcttc
gactttgccagtgacaagccgctgcctaacgccaggttcacatgggaactagtggacccc
gctcaggtcccggatttctacgcgcggcccccgcggagggagaaaggcgtctgccctggg
aataacaatgtggatctaaacgggaatcatagctgcgattcgagcatgtcggacgtactg
acggagtgtacggagcagtgcaccgggctgaggaaaagaccgtgtcacgacaccacggcg
cagagtaagaggtcacgcagcagcccagatgaagttagttgtccagcgctgagccactct
gttgaacacacacccagaaagtccagtcccaggaggcaaacgtga

DBGET integrated database retrieval system