KEGG   Xiphophorus maculatus (southern platyfish): 102236356Help
Entry
102236356         CDS       T02923                                 

Definition
(RefSeq) uncharacterized protein LOC102236356
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102236356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xma03036]
    102236356
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102236356
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102236356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET MecA_N
Motif
Other DBs
NCBI-GeneID: 102236356
NCBI-ProteinID: XP_023204789
LinkDB All DBs
Position
16
AA seq 1830 aa AA seqDB search
MDGYTRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPAPEIRRWGVLKETLLRFQRTH
DFNATFEALTVGELAGDYFNALGSHRQELLRQHVYRYLSAFLLDSGIKIESCDRYSSETN
GAKITTTRHWFVGERVEVLLGCIAELNPADSVVLRAGVNDFSVMYSTRKRCAQLWLGPAA
FINHDCKPNCKFLPGEKNIACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFRHRGKQPDSEEAKEAVGQKYRLRERYLRHHRERGHLTARPSAPGIHAGIFTAIPSRN
SFTQQMRRNALKNKKLNYTKRWRREKQRRSGNYLLKRCRTVPLPSQVTLRDLRIRVRRHS
VDFLLHCKDPKSKERALLQELEEVKPRKATVEENPKSLTLNSSVPANLRSRSAVNSMASN
MKICSRTKSMVHKTQETKTESSSTNTANTTTVCPPVEKDKTCSATKQENTKKAITESQSS
KVESRIAAPTLTVLEKATDDPAITLKQYVTVDLTRLSIPQPAKAGKTQEEEKSGVLGRGR
SQLPPKPGNLPRKQVFRSDVCTATSKRGGKETLLKATDGTDAHKEVAGNPSGCEKKGVDR
VVEIKTVQTELKEEKRDPKLTEAEKVGKSKEGSNIQSVKNAEKVEVKVSGQTKRCLNECP
EDVVIKQAKVLLSDILRKDKSFLDQRLQGDINRGSCNRSVKGRFMKKRSVRKTKLDESQN
GTGTPNDERLVSVCTDLGVKSTQAQSEPKCSELLASSSINSLPHRSAVSTKAQPRPDANP
QSNIPLKKRTFRSSVEIDSQRGPTSASDRVQKNTAVVTSPPAPQQNTSATSGEAKKDNKS
APRRIQKQPVVTRVLRSRPNGSPRGHLLRKVRQCKQENQEEDICEDPVTRRSQKNSQNNL
EISSPEENSSEETKAGFDFKIRLKRRRGRVWDVQGDSLALKTEKHDDSMACDPFKAIMDS
VSILNREMEAHVQASQKSKSRLHRLRRRNDKNNKKQVSDVQMDGVSETKVGLRESVDEKS
DITAKLESRPLLNLNGTSEMLPDTKVEDRLLKSCCLFENASQQKLGPELGSNGLQLPVLK
LRRKVEDIWEVDSKKGLVLPDLRAEVNVKTEVKSHVLGRQKKEETCLRLNSNLMSLKTEP
PPFSLSLSPLSLSSPLNEGKTEAAHSAGERIIERLETYMGGRKQRLKVDKQRKSVPMETP
TPCLSHTLQQIDNSLSRLSEGLCSSQTLEKPTAAGASASGSVIQTPSQSPPFVAADNMLS
AEPSFTNCCEDILDFQCLGFDGYDQPQNILPSSPSDLCSLDPPTDPFSSPLSHSPTDTWS
TETPYLGPPSPGNNFTSEDLQFFPGLVASKSDSGSVQNCEAKGISKDGPNSGFGFSASVN
SDVVSKERIMSKNLGARLSKDDPKTQPSLSVASKPRIFTGNPVVLSQPSINFKATTSQSK
TQLNLKTQGPFHRMTIPSKSQSFPSNQPTVVRGTPAQVSNRFLSPSVLSTKNPNSPENPF
SYQEKPSTVIHRVLKYQGGSQTQNLYSAPCEDTVAASGGARISAKQSQKFVPNVSQKTNI
SFQGFGKDVGHFSSSSNLASSNLHFSRPSSSVSQSFSKNKMASDKQEAAETNMGYKNFSE
MPRPFFFPSKASDCYSSQQDKKLDKTDRHQPCYTQQDAYDFSYSSLSPISQHSSPQLVHS
TPPSTPAPKTQSTASFPYGYQGPPYVLNFSGDHSLTLGLRDGSDGYPGLSATNYTYHCLM
EPSGTQGRLVLEPCGPQLSNPSSLCGFAGLRSQDEHCRKDMQQQCQPGENQGASHYGGVP
MSHPMGTTKPKRVRLVVTDGTVDLDLQYSD
NT seq 5493 nt NT seq  +upstreamnt  +downstreamnt
atggacggctacactagaatgagtgtgaaggagttgtgtgagaccgatgacctggccacc
agtttggtgctggaccctcttctgggcttcagcacccataaaatgaacataagtccggca
ccagagatcagacgctggggtgtcctcaaggagacgctgctgcggtttcagcgaacgcac
gacttcaacgccacgtttgaggcgctgactgttggcgaactcgctggcgactacttcaac
gctctggggagccaccggcaggagctgctgagacaacatgtgtatcgctacctcagtgcc
ttcctgctggacagtgggatcaagatagagtcgtgtgatagatattcgtcggagaccaac
ggagcgaagataacgactaccaggcattggttcgttggagagcgcgtggaggtcctactg
ggctgcatagcggaactgaaccccgcggacagcgtcgtgctgagggcaggggtcaacgac
ttcagcgtcatgtactccacacgtaaacgctgcgctcagctgtggctcgggcccgcagcg
tttatcaaccatgactgcaaaccgaactgcaagtttctccccggtgagaagaacatcgcc
tgcgtggaagtgatccgacccatctcgcctggggaggaaatcacctgttactatggcgcc
agcttcttcggcgaaggcaacgaaatgtgcgaatgctgcacctgcgagaggaacggcgag
ggccacttcaggcacagagggaagcagccggacagcgaggaggcgaaggaggccgtgggc
cagaagtaccggctcagggagcgatacctgcgacaccacagggagagaggacacctgacc
gccaggcccagcgccccggggatccacgccgggatcttcacagcgatcccctccaggaac
tccttcacccagcagatgaggagaaacgctctgaagaacaagaagctgaactacaccaag
aggtggaggcgtgagaagcagaggcggtcggggaattacctgctgaaacgctgccggacc
gttccgctgccgtcccaggtcactctgagggacctgcgcatcagagtgcggcgccactcg
gtggatttcctgctgcactgcaaggatcccaaaagcaaagagagggccttgctgcaggaa
ctagaggaggtgaagccaagaaaagccactgttgaggaaaacccgaaatctttgactttg
aattcctccgtgccagccaatctgagaagcagatccgccgtgaatagcatggcttcgaac
atgaagatctgctcaagaaccaaaagcatggttcataaaacgcaggagacaaagacggag
tccagtagcacaaacacggctaacactactacagtttgtccgcctgttgaaaaggacaaa
acctgcagcgcaacaaagcaggagaacacaaaaaaagcaatcactgaaagtcaaagcagc
aaagttgaatccaggatcgccgctccgactctgaccgtgttggagaaggctactgacgat
ccagcaatcaccctgaagcaatacgttaccgtcgaccttaccaggttatcaatcccgcaa
cccgccaaggctggaaaaacacaagaagaggagaaaagtggtgttttagggagaggaagg
agccagctgccccccaaacctgggaacctgccaagaaaacaggttttcaggtcagacgtc
tgcactgctacgagcaaacgaggagggaaggaaacgctcctcaaggccacagatggaaca
gatgctcacaaagaagtcgccgggaatccatctggctgcgagaagaagggggttgacaga
gttgtggaaataaaaacggtgcaaacggagctcaaggaggagaagagagaccctaagtta
actgaagctgaaaaagtggggaagtcgaaagaagggagtaatatccagagtgttaaaaat
gcagagaaagtggaagttaaagtgtcaggacagacgaagagatgcttgaatgagtgtcct
gaagatgtggtgataaaacaggcaaaggttttgctgtcggacattttaaggaaagataaa
tcttttttagatcagaggctgcagggagacataaacagaggaagttgcaatcgttcagtt
aaggggcggtttatgaaaaaacgaagtgtgcgaaaaactaaattagatgaatcacaaaat
gggacgggaaccccaaacgatgagcgattggtttctgtttgcacggacttgggtgtgaaa
agtacacaggcccagtccgaaccgaagtgcagcgaactgctggcctcctcctccatcaac
tcactacctcacaggtcggccgtttctacgaaggctcagccgcgcccggacgccaacccg
cagtccaacatacctctgaagaaacgcacatttcggagctctgtggagatcgactcgcag
cgaggtccgacttccgcctccgatcgtgttcagaaaaacacggctgtggtgacgtcgcct
ccagccccacaacagaacacgtccgctacgtctggagaagccaagaaagataataaatca
gctccaaggcggatccaaaaacaaccggtagttaccagagtgcttcgctccagacctaac
ggatctccacgaggccacctgctgaggaaagtccggcaatgcaaacaagaaaatcaggag
gaggatatttgtgaagatcctgtcacacgtagatcccaaaaaaactcccagaataacctg
gaaatatcgtcccctgaagaaaacagctcagaggaaacaaaagccggctttgatttcaag
atccgcctcaagcggagaagagggagagtgtgggatgttcagggcgacagcttggcgctg
aaaacggaaaagcacgacgactcgatggcgtgtgatcctttcaaagcaatcatggattct
gtgtccatcttaaaccgagagatggaggctcacgttcaagcgagtcagaagtcgaagagc
cgactgcatcgattgagacgaagaaacgacaaaaacaacaaaaaacaagttagtgacgtc
cagatggatggagttagtgaaactaaagtcggacttcgcgaatctgttgacgaaaaaagt
gacattacagcaaagttggaaagccggcccctgttgaacctgaacggaaccagtgagatg
cttccagacactaaagtggaggatcgtcttttaaaaagctgctgcctgtttgagaacgcg
tcccaacaaaagctggggccagaactgggctcaaacggccttcaattaccagttctgaaa
ctgcggaggaaggtggaggatatctgggaggtggacagcaaaaaggggcttgtactgccc
gacctaagagccgaggttaatgtcaagacagaggtcaagagtcacgtcttagggaggcag
aagaaagaggagacttgtctgagactcaacagcaatctgatgtctctaaaaacagaaccg
ccccctttttccctctctctttcgccgttgtcgctgtcatcacctcttaatgagggaaaa
accgaagctgcacactcagccggagagcgaatcatagaaaggttggagacgtacatgggg
ggaaggaaacagaggctcaaagttgacaaacagcgcaagagtgtgcccatggagacgccc
accccttgtctgagtcacacactccagcagattgacaacagcctctccagactctccgaa
ggcctgtgttcttctcagacgctggagaagcccacagcagctggcgccagcgcctccggt
tctgtgatccagaccccgtcccagtcccccccgtttgtggccgctgacaatatgctgtcc
gccgagcccagcttcaccaactgctgcgaagacatcctggacttccagtgcctcggcttt
gatggatacgaccagccgcaaaacattctcccatcctccccgtcagatctgtgctccctg
gacccacccaccgacccatttagcagtcctctttcccacagcccgaccgacacttggtcc
accgaaacaccctacctgggcccgccaagtccggggaataacttcaccagtgaggatctg
cagtttttcccgggcttggttgcttccaaaagtgactccgggagtgttcagaactgtgaa
gccaagggcatctccaaagacggacccaactctggttttgggttttcagcttcggtaaat
tcagacgttgtgagcaaggaacgtattatgagcaaaaatctgggagcgaggctctccaaa
gacgaccccaaaactcaaccatctttgtccgtcgccagcaagcctcgtattttcaccgga
aatcccgtcgttttaagccagccttccatcaacttcaaggccaccaccagccaatcaaaa
acgcagctcaacctcaaaacccaaggcccgttccatcgcatgaccattccaagtaaatcc
cagtcattcccaagtaaccagccaactgtggtcagaggaacgccggctcaagtgtccaac
agattcctttccccttcagtcctctcaacaaagaatcccaactctcctgaaaatccattt
agctaccaggagaagccatctacggtaatccacagggttctgaagtaccaggggggtagc
cagacgcagaacctgtacagcgcgccgtgcgaggacactgtagctgctagtggcggcgcc
cggatctctgccaaacagagtcagaaatttgttcctaatgtgtctcaaaaaaccaatata
tctttccaggggtttggaaaggatgttggccatttcagttcctccagcaacctcgccagc
tccaaccttcatttcagcagacccagttcctcggtttcacagtctttcagtaaaaacaag
atggcatcagacaaacaggaagcggctgaaactaacatggggtacaaaaacttttccgag
atgccgagacccttcttctttcctagcaaagcatctgactgctactcatcccagcaagac
aagaagctggataaaaccgacagacaccagccatgttacacacagcaggatgcttatgac
tttagctattcctctctctcgcccatttcccagcacagcagccctcaactagtccacagc
actcctccaagtacaccagcacccaaaacccagtccaccgcctccttcccttacggctac
caaggtcccccctatgtgctgaacttcagcggcgaccactcactcactctgggcctgagg
gacggttctgatggctacccgggcctttctgctacaaactacacctaccactgcctgatg
gagccctctggcactcaaggacggctagtccttgaaccttgcggaccccaactgtccaac
ccgtcctcgttgtgcgggttcgctggcctcagaagtcaggacgaacactgccggaaggac
atgcaacagcagtgccagccaggggaaaaccaaggtgcttcacactacggtggggttcct
atgtcgcacccaatgggcaccacaaaacccaaacgggtgcggctggtggtgacggacggt
acggtggacttagatttgcagtactcggactga

DBGET integrated database retrieval system