KEGG   Xiphophorus maculatus (southern platyfish): 102237855Help
Entry
102237855         CDS       T02923                                 

Gene name
ptges
Definition
(RefSeq) prostaglandin E synthase
  KO
K15729  microsomal prostaglandin-E synthase 1 [EC:5.3.99.3]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00590  Arachidonic acid metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102237855 (ptges)
Enzymes [BR:xma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     102237855 (ptges)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102237855
NCBI-ProteinID: XP_005798737
Ensembl: ENSXMAG00000005893
UniProt: M3ZUL6
LinkDB All DBs
Position
8
AA seq 146 aa AA seqDB search
MIRNEVFSCFVFYAVLLVIKMYTIAIITGQVRLRKKAFANPEDALRHGGLQFHREDPYVE
RCRRAHLNDLENILPFLFLGAIYSLTGPSLTVARLHFLVFFLARVLHSLAYLLALRAPTR
SLAYTAAQVPCVSMAVQILMSVASFA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgataagaaacgaggttttctcctgttttgtcttctacgccgtcctcctggtgatcaaa
atgtacaccatcgcgatcataacgggacaagtgaggctgcggaaaaaggctttcgccaac
ccagaggacgcgctgagacacggagggttgcagtttcacagagaggatccctacgtggaa
agatgccgacgggctcacctcaacgacttggagaacatcctccctttcctcttcctgggg
gccatctactccctgaccggaccttcgctaactgtagctcgccttcacttcctggttttt
tttctcgcgcgcgtgctgcacagccttgcctacctgttggccctgcgagcacccacccgt
tccctggcctacaccgccgcacaggtgccttgtgtttccatggcggtgcagatcctgatg
tcagtggcatccttcgcctag

DBGET integrated database retrieval system