KEGG   Xiphophorus maculatus (southern platyfish): 102238393Help
Entry
102238393         CDS       T02923                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12-like
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04371  Apelin signaling pathway
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102238393
   04371 Apelin signaling pathway
    102238393
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102238393
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    102238393
   04031 GTP-binding proteins [BR:xma04031]
    102238393
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102238393
  Exosomal proteins of colorectal cancer cells
   102238393
GTP-binding proteins [BR:xma04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102238393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 102238393
NCBI-ProteinID: XP_005802404
Ensembl: ENSXMAG00000003991
LinkDB All DBs
Position
6
AA seq 72 aa AA seqDB search
MSSKAPSANNLNQARQVVQQLRLEARIDRIKISKASADIVKYCSEHQKTDPLIAGIPASE
NPFKEKKSCTLL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaagctccgagtgccaataacctgaaccaggcccggcaggtggtacagcag
ctgagactagaggcgagaattgacaggataaagatctccaaagcctccgcagacattgtg
aagtactgcagcgagcaccagaaaaccgaccccctcatcgcgggcatccctgcttcagaa
aaccccttcaaggagaagaagtcctgcactttattgtag

DBGET integrated database retrieval system