KEGG   Xiphophorus maculatus (southern platyfish): 111608701Help
Entry
111608701         CDS       T02923                                 

Definition
(RefSeq) anionic trypsin-1-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xma00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111608701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xma01002]
    111608701
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xma04147]
    111608701
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111608701
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111608701
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111608701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 111608701
NCBI-ProteinID: XP_023190298
LinkDB All DBs
Position
5
AA seq 233 aa AA seqDB search
MNSHVSLYKRIIGGQNCNDTERLYHVRLEFDNDTHMSLCGGSLIHRQWILTAAHCWKSEP
GWTTTAKLGVHPRTATQEKQIIQHNPVIYVNKWHYQHDIMLLKLQRPVRNIRPVRLPSGA
TVQLAGEGLTTTSPNNSLSFGASLPPHLQCVDMKVTGFFFTITSGHEFFAEAQNTDAYFG
DSGGGVVFNKKIVGVISSRGKSVSFRNPVFSMDVCDYLEWIRNTTGLNKPKIS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaactcacatgtttctctgtacaagagaatcattggaggtcaaaactgtaatgacaca
gaacgtctttatcatgttcggctggagttcgacaatgatactcatatgagcttgtgtgga
ggatctctgatccaccgtcagtggatcctgactgcagctcactgctggaagtcggagcct
ggatggactaccacagcaaagttaggagttcatccacggactgctacacaggagaaacaa
ataatccaacacaatcctgtgatttatgttaacaaatggcattaccagcatgacatcatg
ttgctgaagcttcagaggccagtaagaaatatccgtcctgttcgtctaccaagtggtgct
acagttcagctggcaggagaaggactaacaacaaccagccccaataattcactctcattc
ggtgcttctcttccaccacatcttcagtgtgtcgacatgaaagttactggttttttcttt
acgattacatctgggcatgaattctttgctgaagcacagaacacagatgcgtactttggt
gactctggtggaggagtggtgttcaacaagaagattgttggtgtgatttctagcagagga
aagagtgtttcatttcggaatccagtttttagcatggatgtgtgtgattacttggagtgg
ataagaaacacaactgggcttaataagcctaaaatatcatga

DBGET integrated database retrieval system