KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_2272Help
Entry
XNC1_2272         CDS       T01274                                 

Gene name
goaG
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00250  Alanine, aspartate and glutamate metabolism
xne00410  beta-Alanine metabolism
xne00640  Propanoate metabolism
xne00650  Butanoate metabolism
xne01100  Metabolic pathways
xne01120  Microbial metabolism in diverse environments
Module
xne_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:xne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    XNC1_2272 (goaG)
   00650 Butanoate metabolism
    XNC1_2272 (goaG)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XNC1_2272 (goaG)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XNC1_2272 (goaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:xne01007]
    XNC1_2272 (goaG)
Enzymes [BR:xne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     XNC1_2272 (goaG)
Amino acid related enzymes [BR:xne01007]
 Aminotransferase (transaminase)
  Class III
   XNC1_2272 (goaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: CBJ90331
UniProt: D3VFL7
LinkDB All DBs
Position
2216979..2218268
Genome map
AA seq 429 aa AA seqDB search
MTESMLAKRRSEAIAKGVGVTTQVYVDRAENAEIWDAHGQRYIDFAAGIAVVNTGHRHPR
VIAAARAQLEQFTHTCHQVVPYENYVALAERLNHLVPGNFVKKTVFVTTGAEAVENAVKI
ARAATGRSGVVAFSGAFHGRTFLGMSLTGKVAPYKMGFGPLVSDIYRIPFPVDLHGISVE
QTMNALENIFKTDIEPARVAAIIIEPVQGEGGFYPAPSGLLESLREIADRYGIVLIADEI
QTGFARTGKLFAMEHHKVAADLTTMAKGLAGGFPLAAVTGRAELMDAVVPGGLGGTFGGN
PVAIAAAHAVLDVIEEEKLTTRAAQLGERLKQCLHELRPRVPQIADIRGLGLMIAVEFNH
ADNPQEPDAGFTNTVRQKALEQGLILLTCGVHGNVVRFLPPLTVQDDVFDEALNILSHVL
LDLSCKEKK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatctatgttggccaaaaggcgtagtgaggctatcgcaaaaggcgttggtgtg
actacacaagtctatgttgatcgtgcagaaaatgctgaaatctgggatgctcacgggcaa
cgctatattgattttgccgccggcatcgccgtggtgaataccggccaccgccacccacgt
gttattgccgcagccagagcgcaattggaacaatttacccacacttgtcatcaggttgtt
ccttatgaaaattatgtcgcgctggctgaacgactgaaccatctggtgccgggtaatttt
gtgaagaagacagtctttgttaccactggggctgaggcggtagaaaacgcagtgaagatt
gcacgtgcggccaccggacgcagtggcgtagtggctttcagtggtgcttttcatggacgt
actttcctcggtatgtcactcaccggcaaagtcgcgccgtataaaatggggttcggcccg
ttggtcagcgacatttatcgtattccgtttccggtcgatctgcacgggatcagtgtcgaa
cagacaatgaacgcgctggaaaatatcttcaaaaccgatattgagcctgcacgcgttgct
gccattatcatcgaacccgtacagggagaaggtggtttctatccggcaccttccggacta
cttgaatccctgcgtgaaattgcggatcgctacggaattgtgctcattgccgatgagatc
cagacgggatttgcgcgcacgggtaaactgttcgcgatggaacatcataaagttgcggcg
gatctgactaccatggcaaaaggtctggcggggggatttccgttggcggcggtaacggga
cgggcagagttgatggacgcggtggtgccgggggggttggggggaacttttggcggcaat
ccggtggcgattgcggctgcccatgcggtgttggatgtcatcgaagaagaaaagctgacc
acgcgggcagcgcagttgggtgagcggctgaaacaatgtctgcatgaattgcggccacgt
gttccgcagatcgccgatatacgtgggcttggattaatgatagccgtggagtttaaccat
gcagataatccgcaagaacccgatgccggctttaccaatacggtgcgtcagaaagcactg
gagcaaggtctgattctgttgacatgtggtgtacacggtaatgtggtccgtttcctgcca
ccgctgactgtacaagatgatgtttttgatgaagcgctcaatattctgagtcatgtattg
ctggatctgagttgtaaagaaaaaaaataa

DBGET integrated database retrieval system