KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3549
Entry
XNC1_3549         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: DUF4400 AntA DUF2207 Babuvirus_MP
Other DBs
NCBI-ProteinID: CBJ91584
UniProt: D3VA20
LinkDB
Position
3425009..3425767
AA seq 252 aa
MAQSENQSRPSSQPPRKHGLLYRLLWEWPWQLIGFMVMSWLFSLLLEYLGMAFFWPEQGA
THSQNMMKTELNYLSSEFTRSLLLSEPSQTVSAWLAQVYQWLFVDSGFMGWVQRQSQYQF
NSRNDFMREFNAVLQGISGHLREYWLATVFITMVTLIRLAILLLSVPLFVMVLLVALVDG
LGRRDLRRYGAGYESSFVYHHAKRGIKPACTVPCVLYLSWPGVVYPTVILLPAAIVLGMA
VVITVSMFKKYL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcacagtcagaaaaccagtcccgcccatcttcccaaccgccccgcaagcatggcctg
ctttatcgtctgttatgggaatggccgtggcaactcattgggtttatggtgatgtcctgg
ctattcagcctgttactggaatatcttggtatggcttttttctggccggaacagggtgcc
actcacagtcagaatatgatgaagacagagcttaactatctctcctcagaatttacccga
agcctgttgctgtcagaaccctcacaaaccgtttcggcatggctggcacaggtttatcag
tggctgtttgtagacagtggttttatgggctgggttcagagacagtcgcaataccagttc
aatagccgcaatgattttatgcgtgaattcaatgcggtattacagggtatatcggggcat
ttgcgggagtattggctggccacggtatttatcacgatggtgacgctgatccggctggca
attttgttgttatctgtacccttgtttgtgatggtgcttttagtcgcattggtcgatgga
ttaggacggcgggatttgcggcgttatggggcagggtatgaatccagttttgtttaccat
catgccaaacgggggattaaaccggcctgcacggttccctgtgtactgtatttatcgtgg
ccgggtgtggtgtatcctaccgtgatattgttgccggcggcgatagtgctgggcatggcg
gtcgtgataacggtctcaatgtttaaaaaatatctttga

DBGET integrated database retrieval system