KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_3667
Entry
XNC1_3667         CDS       T01274                                 

Definition
(GenBank) conserved hypothetical protein; putative membrane protein
Organism
xne  Xenorhabdus nematophila ATCC 19061
SSDB
Motif
Pfam: DUF4400 MtrE
Other DBs
NCBI-ProteinID: CBJ91698
UniProt: D3VAD4
LinkDB
Position
3533428..3534186
AA seq 252 aa
MAQSENHSRPSSQPPRKPGLLYRLLWEWPWQLIGFMVMSWLFSLLLEYLGMAFFWPEQGA
THSQNMMKIELKFLSTEFTRSLLLAEPSQTVSAGLAQAYQWLFVDSGFMGWVQGQSQYQF
NSRNDFMRELNSVLQGVSGHLREYWLATVFITMVTLIRLGILLLSVPLFVMVVLVALVDG
LGRRDLRRYGAGYESSFVYHHAKRGIKPACTVPCVLYLSWPEVVYPTVILLPAAVLLGMA
VVITTSMFKKYL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggcacagtcagaaaatcactcccgcccgtcttcccaaccgccccgcaagcctggcctg
ttgtatcgtctgttatgggaatggccgtggcaacttattgggtttatggtgatgtcctgg
ctgttcagcctgttactggaatatctcgggatggcttttttctggccggaacagggtgcc
actcacagtcagaatatgatgaaaattgaacttaaatttttatccacggaatttacccga
agcctgttgttggctgagccttcacaaaccgtttcggcagggttggcgcaagcctatcaa
tggctgtttgtggacagtggttttatgggctgggttcagggacagtcgcaataccagttc
aatagccgcaatgattttatgcgtgaattaaattccgtattacagggtgtatcggggcat
ttgcgggagtattggctggccacggtgtttatcacgatggtgacgctgatccggctgggg
atcctgctgttatccgtgcccctgtttgtaatggtggtgttagtggcactggttgacggg
ctgggacgacgggatttgcggcgctacggagccgggtatgaatccagttttgtctatcac
catgccaaacggggaattaaaccggcctgcacggttccctgtgtactgtatttatcatgg
ccggaggtagtgtatcccacggtgatattgttgcctgcggcggtgttgctgggtatggcg
gtggtgataacaacgtcgatgtttaagaaatacttatag

DBGET integrated database retrieval system